Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCDK19/Cyclin C
LigandBDBM350228
Substrate/Competitorn/a
Meas. Tech.CDK19/Cyclin C Binding Assay
IC50 25.5±n/a nM
Citation Pastor Fernández JMartínez González SBlanco-Aparicio CHernández Higueras AIGómez De La Oliva CARivero Buceta VRiesco Fagundo RC Condensed tricyclic compounds as protein kinase inhibitors US Patent  US10208056 Publication Date 2/19/2019
More Info.:Get all data from this article,  Assay Method
 
CDK19/Cyclin C
Name:CDK19/Cyclin C
Synonyms:Cyclin-C/Cyclin-dependent kinase 19
Type:Protein
Mol. Mass.:n/a
Description:n/a
Components:This complex has 2 components.
Component 1
Name:Cyclin-dependent kinase 19
Synonyms:CDC2-related protein kinase 6 | CDC2L6 | CDK11 | CDK19 | Cell division cycle 2-like protein kinase 6 | Cell division protein kinase 19 | Cyclin-dependent kinase 11 | Death-preventing kinase | KIAA1028
Type:Serine/Threonine protein kinase
Mol. Mass.:56816.68
Organism:Homo sapiens (Human)
Description:Q9BWU1
Residue:502
Sequence:
MDYDFKAKLAAERERVEDLFEYEGCKVGRGTYGHVYKARRKDGKDEKEYALKQIEGTGIS
MSACREIALLRELKHPNVIALQKVFLSHSDRKVWLLFDYAEHDLWHIIKFHRASKANKKP
MQLPRSMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLF
NSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQED
IKTSNPFHHDQLDRIFSVMGFPADKDWEDIRKMPEYPTLQKDFRRTTYANSSLIKYMEKH
KVKPDSKVFLLLQKLLTMDPTKRITSEQALQDPYFQEDPLPTLDVFAGCQIPYPKREFLN
EDDPEEKGDKNQQQQQNQHQQPTAPPQQAAAPPQAPPPQQNSTQTNGTAGGAGAGVGGTG
AGLQHSQDSSLNQVPPNKKPRLGPSGANSGGPVMPSDYQHSSSRLNYQSSVQGSSQSQST
LGYSSSSQQSSQYHPSHQAHRY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:Cyclin-C
Synonyms:CCNC | Cyclin C | SRB11 homolog | hSRB11
Type:PROTEIN
Mol. Mass.:33244.88
Organism:Homo sapiens (Human)
Description:ChEMBL_107900
Residue:283
Sequence:
MAGNFWQSSHYLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLRQQ
VIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLIAAATSVLKTRF
SYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIV
NDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYEQ
WKNFDERKEMATILSKMPKPKPPPNSEGEQGPNGSQNSSYSQS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM350228
n/a
NameBDBM350228
Synonyms:US10208056, Compound 58
TypeSmall organic molecule
Emp. Form.C12H11N3O2
Mol. Mass.229.2346
SMILESCC1Oc2cnccc2-c2[nH]c(cc12)C(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: