Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targethaspin
LigandBDBM350269
Substrate/Competitorn/a
Meas. Tech.Haspin Kinase Assay
IC50 8.91±n/a nM
Citation Pastor Fernández JMartínez González SBlanco-Aparicio CHernández Higueras AIGómez De La Oliva CARivero Buceta VRiesco Fagundo RC Condensed tricyclic compounds as protein kinase inhibitors US Patent  US10208056 Publication Date 2/19/2019  Article
More Info.:Get all data from this article,  Assay Method
 
haspin
Name:Serine/threonine-protein kinase haspin
Synonyms:Germ cell-specific gene 2 protein | H-haspin | Haploid germ cell-specific nuclear protein kinase
Type:PROTEIN
Mol. Mass.:88531.28
Organism:Homo sapiens (Human)
Description:ChEMBL_1510616
Residue:798
Sequence:
MAASLPGPGSRLFRTYGAADGRRQRRPGREAAQWFPPQDRRRFFNSSGSSDASIGDPSQS
DDPDDPDDPDFPGSPVRRRRRRPGGRVPKDRPSLTVTPKRWKLRARPSLTVTPRRLGLRA
RPPQKCSTPCGPLRLPPFPSRDSGRLSPDLSVCGQPRDGDELGISASLFSSLASPCPGSP
TPRDSVISIGTSACLVAASAVPSGLHLPEVSLDRASLPCSQEEATGGAKDTRMVHQTRAS
LRSVLFGLMNSGTPEDSEFRADGKNMRESCCKRKLVVGNGPEGPGLSSTGKRRATGQDSC
QERGLQEAVRREHQEASVPKGRIVPRGIDRLERTRSSRKSKHQEATETSLLHSHRFKKGQ
KLGKDSFPTQDLTPLQNVCFWTKTRASFSFHKKKIVTDVSEVCSIYTTATSLSGSLLSEC
SNRPVMNRTSGAPSSWHSSSMYLLSPLNTLSISNKKASDAEKVYGECSQKGPVPFSHCLP
TEKLQRCEKIGEGVFGEVFQTIADHTPVAIKIIAIEGPDLVNGSHQKTFEEILPEIIISK
ELSLLSGEVCNRTEGFIGLNSVHCVQGSYPPLLLKAWDHYNSTKGSANDRPDFFKDDQLF
IVLEFEFGGIDLEQMRTKLSSLATAKSILHQLTASLAVAEASLRFEHRDLHWGNVLLKKT
SLKKLHYTLNGKSSTIPSCGLQVSIIDYTLSRLERDGIVVFCDVSMDEDLFTGDGDYQFD
IYRLMKKENNNRWGEYHPYSNVLWLHYLTDKMLKQMTFKTKCNTPAMKQIKRKIQEFHRT
MLNFSSATDLLCQHSLFK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM350269
n/a
NameBDBM350269
Synonyms:US10208056, Compound 104
TypeSmall organic molecule
Emp. Form.C17H18ClN3O3
Mol. Mass.347.796
SMILESCCn1c(C(N)=O)c(Cl)c2c1-c1ccncc1OC21CCOCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: