| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mitogen-activated protein kinase 14 |
|---|
| Ligand | BDBM16346 |
|---|
| Substrate/Competitor | biotinylated GST-ATF2 |
|---|
| Meas. Tech. | Enzyme Inhibition Assay |
|---|
| pH | 7.2±n/a |
|---|
| Temperature | 303.15±n/a K |
|---|
| IC50 | 2.2±n/a nM |
|---|
| Citation |  McClure, KF; Letavic, MA; Kalgutkar, AS; Gabel, CA; Audoly, L; Barberia, JT; Braganza, JF; Carter, D; Carty, TJ; Cortina, SR; Dombroski, MA; Donahue, KM; Elliott, NC; Gibbons, CP; Jordan, CK; Kuperman, AV; Labasi, JM; Laliberte, RE; McCoy, JM; Naiman, BM; Nelson, KL; Nguyen, HT; Peese, KM; Sweeney, FJ; Taylor, TJ; Trebino, CE; Abramov, YA; Laird, ER; Volberg, WA; Zhou, J; Bach, J; Lombardo, F Structure-activity relationships of triazolopyridine oxazole p38 inhibitors: identification of candidates for clinical development. Bioorg Med Chem Lett16:4339-44 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Mitogen-activated protein kinase 14 |
|---|
| Name: | Mitogen-activated protein kinase 14 |
|---|
| Synonyms: | CSAID-binding protein | CSBP | CSBP1 | CSBP2 | CSPB1 | Cytokine suppressive anti-inflammatory drug-binding protein | MAP kinase 14 | MAP kinase MXI2 | MAP kinase p38 alpha | MAPK 14 | MAPK14 | MAX-interacting protein 2 | MK14_HUMAN | MXI2 | Mitogen-activated protein kinase p38 alpha | SAPK2A | Stress-activated protein kinase 2a | p38 MAP kinase alpha/beta |
|---|
| Type: | Serine/threonine-protein kinase |
|---|
| Mol. Mass.: | 41286.76 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q16539 |
|---|
| Residue: | 360 |
|---|
| Sequence: | MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG
TPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
|
|
|
|---|
| BDBM16346 |
|---|
| biotinylated GST-ATF2 |
|---|
| Name: | biotinylated GST-ATF2 |
|---|
| Synonyms: | ATF-2-GST | ATF2 | Activating transcription factor 2 | Activating transcription factor 2-GST fusion | GST-ATF2 | biotinylated ATF2 substrate | biotinylated activating transcription factor 2 |
|---|
| Type: | Other Protein Type |
|---|
| Mol. Mass.: | 12237.77 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 109 |
|---|
| Sequence: | MSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARNDSVIVADQTPTPTRFLKN
CEEVGLFNELASPFENEFKKASEDDIKKMPLDLSPLATPIIRSKIEEPS
|
|
|
|---|
Search and Browse
