Reaction Details |
| Report a problem with these data |
Target | Aldo-keto reductase family 1 member B1 |
---|
Ligand | BDBM16463 |
---|
Substrate/Competitor | BDBM16241 |
---|
Meas. Tech. | Enzyme Inhibition Assay |
---|
pH | 6.6±n/a |
---|
Temperature | 310.15±n/a K |
---|
IC50 | 34±n/a nM |
---|
Citation | Van Zandt, MC; Jones, ML; Gunn, DE; Geraci, LS; Jones, JH; Sawicki, DR; Sredy, J; Jacot, JL; Dicioccio, AT; Petrova, T; Mitschler, A; Podjarny, AD Discovery of 3-[(4,5,7-trifluorobenzothiazol-2-yl)methyl]indole-N-acetic acid (lidorestat) and congeners as highly potent and selective inhibitors of aldose reductase for treatment of chronic diabetic complications. J Med Chem48:3141-52 (2005) [PubMed] Article |
---|
More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
---|
|
Aldo-keto reductase family 1 member B1 |
---|
Name: | Aldo-keto reductase family 1 member B1 |
Synonyms: | AKR1B1 | ALDR1 | ALDR_HUMAN | ALR2 | AR | Aldo-keto reductase family 1 member B1 (AKR1B1) | Aldose Reductase (ALR2) | Aldose reductase | Aldose reductase (AR) |
Type: | Protein |
Mol. Mass.: | 35855.50 |
Organism: | Homo sapiens (Human) |
Description: | P15121. 4LAU; 2IKI; 4LB4; 2FZD; 2FZ8; 1US0 |
Residue: | 316 |
Sequence: | MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQ
EKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGK
EFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKP
AVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAK
HNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCA
LLSCTSHKDYPFHEEF
|
|
|
BDBM16463 |
---|
BDBM16241 |
---|
Name | BDBM16463 |
Synonyms: | 2-{3-[(4-fluoro-1,3-benzothiazol-2-yl)methyl]-1H-indol-1-yl}acetic acid | Indoleacetic Acid Inhibitor 22 |
Type | Small organic molecule |
Emp. Form. | C18H13FN2O2S |
Mol. Mass. | 340.371 |
SMILES | OC(=O)Cn1cc(Cc2nc3c(F)cccc3s2)c2ccccc12 |
Structure |
|