Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCathepsin B
LigandBDBM16501
Substrate/CompetitorBDBM16498
Meas. Tech.Inhibitory Activity Measurement of Bovine Cathepsin B.
pH6±n/a
Temperature313.15±n/a K
IC50 410±n/a nM
CommentsThe second order rate constant, k2 =25500 M-1s-1.
Citation Watanabe DYamamoto ATomoo KMatsumoto KMurata MKitamura KIshida T Quantitative evaluation of each catalytic subsite of cathepsin B for inhibitory activity based on inhibitory activity-binding mode relationship of epoxysuccinyl inhibitors by X-ray crystal structure analyses of complexes. J Mol Biol 362:979-93 (2006) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Cathepsin B
Name:Cathepsin B
Synonyms:BCSB | Cathepsin B precursor | Cathepsin B1
Type:Enzyme
Mol. Mass.:36657.87
Organism:Bos taurus (bovine)
Description:Bovine spleen CB was purchased from Sigma Co. (USA).
Residue:335
Sequence:
MWRLLATLSCLLVLTSARSSLYFPPLSDELVNFVNKQNTTWKAGHNFYNVDLSYVKKLCG
AILGGPKLPQRDAFAADVVLPESFDAREQWPNCPTIKEIRDQGSCGSCWAFGAVEAISDR
ICIHSNGRVNVEVSAEDMLTCCGGECGDGCNGGFPSGAWNFWTKKGLVSGGLYNSHVGCR
PYSIPPCEHHVNGSRPPCTGEGDTPKCSKTCEPGYSPSYKEDKHFGCSSYSVANNEKEIM
AEIYKNGPVEGAFSVYSDFLLYKSGVYQHVSGEIMGGHAIRILGWGVENGTPYWLVGNSW
NTDWGDNGFFKILRGQDHCGIESEIVAGMPCTHQY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM16501
BDBM16498
NameBDBM16501
Synonyms:(2S)-2-[(2S,3R)-2-{[(2S,3S)-3-(ethoxycarbonyl)oxiran-2-yl]formamido}-3-hydroxybutanamido]-3-methylpentanoic acid | CA inhibitor 4 | CA042 | EtO-tES-Thr-Ile-OH | N-{[(2S,3S)-3-(ethoxycarbonyl)oxiran-2-yl]carbonyl}-L-threonyl-L-isoleucine | epoxysuccinyl derivative 4
TypeSmall organic molecule
Emp. Form.C16H26N2O8
Mol. Mass.374.3862
SMILES[H][C@@]1(O[C@]1([H])C(=O)OCC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)CC)C(O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: