Reaction Details |
| Report a problem with these data |
Target | Cathepsin B |
---|
Ligand | BDBM16501 |
---|
Substrate/Competitor | BDBM16498 |
---|
Meas. Tech. | Inhibitory Activity Measurement of Bovine Cathepsin B. |
---|
pH | 6±n/a |
---|
Temperature | 313.15±n/a K |
---|
IC50 | 410±n/a nM |
---|
Comments | The second order rate constant, k2 =25500 M-1s-1. |
---|
Citation | Watanabe, D; Yamamoto, A; Tomoo, K; Matsumoto, K; Murata, M; Kitamura, K; Ishida, T Quantitative evaluation of each catalytic subsite of cathepsin B for inhibitory activity based on inhibitory activity-binding mode relationship of epoxysuccinyl inhibitors by X-ray crystal structure analyses of complexes. J Mol Biol362:979-93 (2006) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Cathepsin B |
---|
Name: | Cathepsin B |
Synonyms: | BCSB | CATB_BOVIN | CTSB | Cathepsin B precursor | Cathepsin B1 |
Type: | Enzyme |
Mol. Mass.: | 36657.87 |
Organism: | Bos taurus (bovine) |
Description: | Bovine spleen CB was purchased from Sigma Co. (USA). |
Residue: | 335 |
Sequence: | MWRLLATLSCLLVLTSARSSLYFPPLSDELVNFVNKQNTTWKAGHNFYNVDLSYVKKLCG
AILGGPKLPQRDAFAADVVLPESFDAREQWPNCPTIKEIRDQGSCGSCWAFGAVEAISDR
ICIHSNGRVNVEVSAEDMLTCCGGECGDGCNGGFPSGAWNFWTKKGLVSGGLYNSHVGCR
PYSIPPCEHHVNGSRPPCTGEGDTPKCSKTCEPGYSPSYKEDKHFGCSSYSVANNEKEIM
AEIYKNGPVEGAFSVYSDFLLYKSGVYQHVSGEIMGGHAIRILGWGVENGTPYWLVGNSW
NTDWGDNGFFKILRGQDHCGIESEIVAGMPCTHQY
|
|
|
BDBM16501 |
---|
BDBM16498 |
---|
Name | BDBM16501 |
Synonyms: | (2S)-2-[(2S,3R)-2-{[(2S,3S)-3-(ethoxycarbonyl)oxiran-2-yl]formamido}-3-hydroxybutanamido]-3-methylpentanoic acid | CA inhibitor 4 | CA042 | EtO-tES-Thr-Ile-OH | N-{[(2S,3S)-3-(ethoxycarbonyl)oxiran-2-yl]carbonyl}-L-threonyl-L-isoleucine | epoxysuccinyl derivative 4 |
Type | Small organic molecule |
Emp. Form. | C16H26N2O8 |
Mol. Mass. | 374.3862 |
SMILES | [H][C@@]1(O[C@]1([H])C(=O)OCC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)CC)C(O)=O |r| |
Structure |
|