Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMAP Kinase p38 beta
LigandBDBM16530
Substrate/Competitorbiotinylated GST-ATF2
Meas. Tech.Enzyme Inhibition Scintillation Proximity Assay
IC50 2±n/a nM
Citation Natarajan SRHeller STNam KSingh SBScapin GPatel SThompson JEFitzgerald CEO'Keefe SJ p38 MAP kinase inhibitors. Part 6: 2-arylpyridazin-3-ones as templates for inhibitor design. Bioorg Med Chem Lett 16:5809-13 (2006) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
MAP Kinase p38 beta
Name:MAP Kinase p38 beta
Synonyms:Mitogen-activated protein kinase 11 | Mitogen-activated protein kinase p38 beta | p38B
Type:Enzyme
Mol. Mass.:41390.66
Organism:Mus musculus (mouse)
Description:Q9WUI1
Residue:364
Sequence:
MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQ
SLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQ
ALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGNDYIDQLKRIMEVVG
TPSPEVLAKISSEHARTYIQSLPPMPQKDLSSVFHGANPLAIDLLGRMLVLDSDQRVSAA
EALAHAYFSQYHDPDDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKPLEPSQLPGTH
EIEQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM16530
biotinylated GST-ATF2
Name:biotinylated GST-ATF2
Synonyms:ATF-2-GST | ATF2 | Activating transcription factor 2 | Activating transcription factor 2-GST fusion | GST-ATF2 | biotinylated ATF2 substrate | biotinylated Activating transcription factor 2 | biotinylated activating transcription factor 2
Type:Other Protein Type
Mol. Mass.:12237.77
Organism:Homo sapiens (Human)
Description:n/a
Residue:109
Sequence:
MSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARNDSVIVADQTPTPTRFLKN
CEEVGLFNELASPFENEFKKASEDDIKKMPLDLSPLATPIIRSKIEEPS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff: