Reaction Details |
| Report a problem with these data |
Target | RAC-alpha serine/threonine-protein kinase [139-480,S378A,S381A,T450D,S473D] |
---|
Ligand | BDBM16546 |
---|
Substrate/Competitor | biotinylated Akt peptide substrate |
---|
Meas. Tech. | Akt Kinase Assay |
---|
IC50 | 2.1±n/a nM |
---|
Citation | Zhu, GD; Gandhi, VB; Gong, J; Thomas, S; Woods, KW; Song, X; Li, T; Diebold, RB; Luo, Y; Liu, X; Guan, R; Klinghofer, V; Johnson, EF; Bouska, J; Olson, A; Marsh, KC; Stoll, VS; Mamo, M; Polakowski, J; Campbell, TJ; Martin, RL; Gintant, GA; Penning, TD; Li, Q; Rosenberg, SH; Giranda, VL Syntheses of potent, selective, and orally bioavailable indazole-pyridine series of protein kinase b/akt inhibitors with reduced hypotension. J Med Chem50:2990-3003 (2007) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
RAC-alpha serine/threonine-protein kinase [139-480,S378A,S381A,T450D,S473D] |
---|
Name: | RAC-alpha serine/threonine-protein kinase [139-480,S378A,S381A,T450D,S473D] |
Synonyms: | AKT1 | AKT1_HUMAN | C-AKT | PKB | Protein kinase B (Akt 1) | Protein kinase B alpha | RAC | RAC-PK-alpha |
Type: | Enzyme |
Mol. Mass.: | 39513.28 |
Organism: | Homo sapiens (Human) |
Description: | Recombinant His-tagged Akt1 (S378A, S381A, T450D,
S473D; 139-480) |
Residue: | 342 |
Sequence: | AKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIVAKDEVAHTLTE
NRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLSRERVFSEDRARFYGAEIV
SALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGIKDGATMKTFCGTPEYLAP
EVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLGPEAKA
LLAGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYF
DEEFTAQMITIDPPDQDDSMECVDSERRPHFPQFDYSASGTA
|
|
|
BDBM16546 |
---|
biotinylated Akt peptide substrate |
---|
Name: | biotinylated Akt peptide substrate |
Synonyms: | n/a |
Type: | Biotinylated Peptide |
Mol. Mass.: | 3178.04 |
Organism: | n/a |
Description: | Km=15 uM |
Residue: | 28 |
Sequence: | biotin-Ahx-EELSPFRGRSRSAPPNLWAAQR
|
|
|