Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein kinase B (Akt 1)
LigandBDBM16549
Substrate/Competitorbiotinylated Akt peptide substrate
Meas. Tech.Akt Kinase Assay
IC50 3.1±n/a nM
Citation Zhu GDGandhi VBGong JThomas SWoods KWSong XLi TDiebold RBLuo YLiu XGuan RKlinghofer VJohnson EFBouska JOlson AMarsh KCStoll VSMamo MPolakowski JCampbell TJMartin RLGintant GAPenning TDLi QRosenberg SHGiranda VL Syntheses of potent, selective, and orally bioavailable indazole-pyridine series of protein kinase b/akt inhibitors with reduced hypotension. J Med Chem 50:2990-3003 (2007) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Protein kinase B (Akt 1)
Name:Protein kinase B (Akt 1)
Synonyms:C-AKT | Protein kinase B alpha | RAC-PK-alpha
Type:Enzyme
Mol. Mass.:39513.28
Organism:Homo sapiens (Human)
Description:Recombinant His-tagged Akt1 (S378A, S381A, T450D, S473D; 139-480)
Residue:342
Sequence:
AKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIVAKDEVAHTLTE
NRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLSRERVFSEDRARFYGAEIV
SALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGIKDGATMKTFCGTPEYLAP
EVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLGPEAKA
LLAGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYF
DEEFTAQMITIDPPDQDDSMECVDSERRPHFPQFDYSASGTA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM16549
biotinylated Akt peptide substrate
Name:biotinylated Akt peptide substrate
Synonyms:n/a
Type:Biotinylated Peptide
Mol. Mass.:3178.04
Organism:n/a
Description:Km=15 uM
Residue:28
Sequence:
biotin-Ahx-EELSPFRGRSRSAPPNLWAAQR