Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetUSP1/UAF1
LigandBDBM352011
Substrate/Competitorn/a
Meas. Tech.Inhibition Assay
IC50 43.0±n/a nM
Citation Maloney DJRosenthal ASJadhav ADexheimer TSSimeonov AZhuang ZLiang QLuci DK Inhibitors of the USP1/UAF1 deubiquitinase complex and uses thereof US Patent  US9802904 Publication Date 10/31/2017
More Info.:Get all data from this article,  Assay Method
 
USP1/UAF1
Name:USP1/UAF1
Synonyms:Ubiquitin carboxyl-terminal hydrolase 1/WD repeat-containing protein 48
Type:Protein
Mol. Mass.:n/a
Description:n/a
Components:This complex has 2 components.
Component 1
Name:Ubiquitin carboxyl-terminal hydrolase 1/WD repeat-containing protein 48
Synonyms:KIAA1449 | UAF1 | USP1-associated factor 1 | WD repeat endosomal protein | WD repeat-containing protein 48 | WDR48 | p80
Type:PROTEIN
Mol. Mass.:76215.66
Organism:Homo sapiens (Human)
Description:ChEMBL_109642
Residue:677
Sequence:
MAAHHRQNTAGRRKVQVSYVIRDEVEKYNRNGVNALQLDPALNRLFTAGRDSIIRIWSVN
QHKQDPYIASMEHHTDWVNDIVLCCNGKTLISASSDTTVKVWNAHKGFCMSTLRTHKDYV
KALAYAKDKELVASAGLDRQIFLWDVNTLTALTASNNTVTTSSLSGNKDSIYSLAMNQLG
TIIVSGSTEKVLRVWDPRTCAKLMKLKGHTDNVKALLLNRDGTQCLSGSSDGTIRLWSLG
QQRCIATYRVHDEGVWALQVNDAFTHVYSGGRDRKIYCTDLRNPDIRVLICEEKAPVLKM
ELDRSADPPPAIWVATTKSTVNKWTLKGIHNFRASGDYDNDCTNPITPLCTQPDQVIKGG
ASIIQCHILNDKRHILTKDTNNNVAYWDVLKACKVEDLGKVDFEDEIKKRFKMVYVPNWF
SVDLKTGMLTITLDESDCFAAWVSAKDAGFSSPDGSDPKLNLGGLLLQALLEYWPRTHVN
PMDEEENEVNHVNGEQENRVQKGNGYFQVPPHTPVIFGEAGGRTLFRLLCRDSGGETESM
LLNETVPQWVIDITVDKNMPKFNKIPFYLQPHASSGAKTLKKDRLSASDMLQVRKVMEHV
YEKIINLDNESQTTSSSNNEKPGEQEKEEDIAVLAEEKIELLCQDQVLDPNMDLRTVKHF
IWKSGGDLTLHYRQKST
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:Ubiquitin carboxyl-terminal hydrolase 1
Synonyms:Deubiquitinating enzyme 1 | USP1 | Ubiquitin carboxyl-terminal hydrolase 1/WD repeat-containing protein 48  | Ubiquitin thioesterase 1 | Ubiquitin-specific-processing protease 1 | hUBP
Type:PROTEIN
Mol. Mass.:88191.62
Organism:Homo sapiens (Human)
Description:ChEMBL_104169
Residue:785
Sequence:
MPGVIPSESNGLSRGSPSKKNRLSLKFFQKKETKRALDFTDSQENEEKASEYRASEIDQV
VPAAQSSPINCEKRENLLPFVGLNNLGNTCYLNSILQVLYFCPGFKSGVKHLFNIISRKK
EALKDEANQKDKGNCKEDSLASYELICSLQSLIISVEQLQASFLLNPEKYTDELATQPRR
LLNTLRELNPMYEGYLQHDAQEVLQCILGNIQETCQLLKKEEVKNVAELPTKVEEIPHPK
EEMNGINSIEMDSMRHSEDFKEKLPKGNGKRKSDTEFGNMKKKVKLSKEHQSLEENQRQT
RSKRKATSDTLESPPKIIPKYISENESPRPSQKKSRVKINWLKSATKQPSILSKFCSLGK
ITTNQGVKGQSKENECDPEEDLGKCESDNTTNGCGLESPGNTVTPVNVNEVKPINKGEEQ
IGFELVEKLFQGQLVLRTRCLECESLTERREDFQDISVPVQEDELSKVEESSEISPEPKT
EMKTLRWAISQFASVERIVGEDKYFCENCHHYTEAERSLLFDKMPEVITIHLKCFAASGL
EFDCYGGGLSKINTPLLTPLKLSLEEWSTKPTNDSYGLFAVVMHSGITISSGHYTASVKV
TDLNSLELDKGNFVVDQMCEIGKPEPLNEEEARGVVENYNDEEVSIRVGGNTQPSKVLNK
KNVEAIGLLGGQKSKADYELYNKASNPDKVASTAFAENRNSETSDTTGTHESDRNKESSD
QTGINISGFENKISYVVQSLKEYEGKWLLFDDSEVKVTEEKDFLNSLSPSTSPTSTPYLL
FYKKL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM352011
n/a
NameBDBM352011
Synonyms:US9802904, 72
TypeSmall organic molecule
Emp. Form.C27H28N4
Mol. Mass.408.538
SMILESCC(C)c1ccccc1-c1ncc(C)c(NCc2ccc(cc2)-c2ccc(C)nc2)n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: