Reaction Details |
 | Report a problem with these data |
Target | cAMP-Dependent Protein Kinase (PKA) |
---|
Ligand | BDBM16795 |
---|
Substrate/Competitor | biotinylated kemptide |
---|
Meas. Tech. | Akt Kinase Assay |
---|
IC50 | 274±n/a nM |
---|
Citation | Zhu GD; Gong J; Gandhi VB; Woods K; Luo Y; Liu X; Guan R; Klinghofer V; Johnson EF; Stoll VS; Mamo M; Li Q; Rosenberg SH; Giranda VL Design and synthesis of pyridine-pyrazolopyridine-based inhibitors of protein kinase B/Akt. Bioorg Med Chem 15:2441-52 (2007) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
cAMP-Dependent Protein Kinase (PKA) |
---|
Name: | cAMP-dependent protein kinase A |
Synonyms: | PKA C-alpha | PKC | Protein Kinase C | Protein Kinase C, bovine brain | cAMP-dependent Protein Kinase, bovine heart | cAMP-dependent protein kinase A | cAMP-dependent protein kinase alpha-catalytic subunit | cAMP-dependent protein kinase, alpha-catalytic subunit |
Type: | Enzyme Complex |
Mol. Mass.: | 40627.77 |
Organism: | Bos taurus (bovine) |
Description: | The PKA holoenzyme purified from bovine heart, exists as an inactive tetrameric complex, which consists of a regulatory dimer associated with two catalytic subunits. It requires cAMP to activate the enzymatic reaction. |
Residue: | 351 |
Sequence: | MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVML
VKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMV
MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFAT
TDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
|
|
|
BDBM16795 |
---|
biotinylated kemptide |
---|
Name: | biotinylated kemptide |
Synonyms: | n/a |
Type: | Biotinylated Peptide |
Mol. Mass.: | 1353.09 |
Organism: | n/a |
Description: | n/a |
Residue: | 12 |
Sequence: | |