Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetcAMP-Dependent Protein Kinase (PKA)
LigandBDBM16795
Substrate/Competitorbiotinylated kemptide
Meas. Tech.Akt Kinase Assay
IC50 274±n/a nM
Citation Zhu GDGong JGandhi VBWoods KLuo YLiu XGuan RKlinghofer VJohnson EFStoll VSMamo MLi QRosenberg SHGiranda VL Design and synthesis of pyridine-pyrazolopyridine-based inhibitors of protein kinase B/Akt. Bioorg Med Chem 15:2441-52 (2007) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
cAMP-Dependent Protein Kinase (PKA)
Name:cAMP-dependent protein kinase A
Synonyms:PKA C-alpha | PKC | Protein Kinase C | Protein Kinase C, bovine brain | cAMP-dependent Protein Kinase, bovine heart | cAMP-dependent protein kinase A | cAMP-dependent protein kinase alpha-catalytic subunit | cAMP-dependent protein kinase, alpha-catalytic subunit
Type:Enzyme Complex
Mol. Mass.:40627.77
Organism:Bos taurus (bovine)
Description:The PKA holoenzyme purified from bovine heart, exists as an inactive tetrameric complex, which consists of a regulatory dimer associated with two catalytic subunits. It requires cAMP to activate the enzymatic reaction.
Residue:351
Sequence:
MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVML
VKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMV
MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFAT
TDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM16795
biotinylated kemptide
Name:biotinylated kemptide
Synonyms:n/a
Type:Biotinylated Peptide
Mol. Mass.:1353.09
Organism:n/a
Description:n/a
Residue:12
Sequence:
biotin-hx-LRRASLG