Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein kinase B (Akt 1)
LigandBDBM16978
Substrate/Competitorbiotinylated Akt peptide substrate
Meas. Tech.Akt Kinase Assay
IC50 3.4±n/a nM
Citation Zhu GDGong JClaiborne AWoods KWGandhi VBThomas SLuo YLiu XShi YGuan RMagnone SRKlinghofer VJohnson EFBouska JShoemaker AOleksijew AStoll VSDe Jong ROltersdorf TLi QRosenberg SHGiranda VL Isoquinoline-pyridine-based protein kinase B/Akt antagonists: SAR and in vivo antitumor activity. Bioorg Med Chem Lett 16:3150-5 (2006) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Protein kinase B (Akt 1)
Name:Protein kinase B (Akt 1)
Synonyms:C-AKT | Protein kinase B alpha | RAC-PK-alpha
Type:Enzyme
Mol. Mass.:39513.28
Organism:Homo sapiens (Human)
Description:Recombinant His-tagged Akt1 (S378A, S381A, T450D, S473D; 139-480)
Residue:342
Sequence:
AKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIVAKDEVAHTLTE
NRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLSRERVFSEDRARFYGAEIV
SALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGIKDGATMKTFCGTPEYLAP
EVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLGPEAKA
LLAGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYF
DEEFTAQMITIDPPDQDDSMECVDSERRPHFPQFDYSASGTA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM16978
biotinylated Akt peptide substrate
Name:biotinylated Akt peptide substrate
Synonyms:n/a
Type:Biotinylated Peptide
Mol. Mass.:3178.04
Organism:n/a
Description:Km=15 uM
Residue:28
Sequence:
biotin-Ahx-EELSPFRGRSRSAPPNLWAAQR