Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCoagulation factor X
LigandBDBM17135
Substrate/CompetitorBDBM12658
Meas. Tech.Enzyme Inhibition Assay
Ki 0.06±n/a nM
Citation Ye BArnaiz DOChou YLGriedel BDKaranjawala RLee WMorrissey MMSacchi KLSakata STShaw KJWu SCZhao ZAdler MCheeseman SDole WPEwing JFitch RLentz DLiang ALight DMorser JPost JRumennik GSubramanyam BSullivan MEVergona RWalters JWang YXWhite KAWhitlow MKochanny MJ Thiophene-anthranilamides as highly potent and orally available factor xa inhibitors J Med Chem 50:2967-80 (2007) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Coagulation factor X
Name:Coagulation factor X
Synonyms:Coagulation factor X precursor | F10 | Factor Xa (fXa) | Stuart factor
Type:Enzyme
Mol. Mass.:54255.03
Organism:Rattus norvegicus (rat)
Description:n/a
Residue:482
Sequence:
MESPVRLSLLYVVLASLLLPGRSVFINRERANNVLQRIRRANSFFEEIKKGNLERECVEE
ICSFEEAREVFEDNEKTTEFWNKYEDGDQCESSPCQNQGECRDGLGSYTCTCTEGFEGKN
CELFVRKLCSLDNGDCDQFCREEQNSVVCSCAKGYFLGNDGKSCLSTAPFPCGKTNKGRA
KRSVALNTSNSEPDPEDLMPDADILYPTESPSELLNLNKTEPEANSDDVIRIVGGQECKR
GECPWQALLFSDEETDGFCGGTILNEFYILTAAHCLHQAKRFKVRVGDLNTEQEDGGEMV
HEVDMIIKHNKFQRDTYDFDIAMLRLKTPITFRENVAPACLPQKDWAEATLMTQKTGIVS
GFGRTHEKGRQSKVLKMMEVPYVDRNTCRLSTSFSITQNMFCAGYDAKQEDACQGDSGGP
HVTRFKDTYFVTGIVSWGEGCARKGKYGIYTKVTAFLKWIDRSMKARVGPTSETPRLTHP
PY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM17135
BDBM12658
NameBDBM17135
Synonyms:3-chloro-N-{4-chloro-2-[(5-chloropyridin-2-yl)carbamoyl]-6-methoxyphenyl}-4-{[2-(methylamino)-1H-imidazol-1-yl]methyl}thiophene-2-carboxamide | Thiophene-Anthranilamide, 17m | ZK 813039 | ZK813039
TypeSmall organic molecule
Emp. Form.C23H19Cl3N6O3S
Mol. Mass.565.859
SMILESCNc1nccn1Cc1csc(C(=O)Nc2c(OC)cc(Cl)cc2C(=O)Nc2ccc(Cl)cn2)c1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: