Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAndrogen Receptor
LigandBDBM354694
Substrate/Competitorn/a
Meas. Tech.Binding Assay
IC50 23.9±n/a nM
Citation Choi SPChoi SMSon BHKim HJKim JMJang BJSung JHLee JHKim EKang KKKim S Oxazolidine-based compound and selective androgen receptor agonist comprising same US Patent  US9809583 Publication Date 11/7/2017
More Info.:Get all data from this article,  Assay Method
 
Androgen Receptor
Name:Androgen Receptor
Synonyms:n/a
Type:n/a
Mol. Mass.:97086.15
Organism:Chlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus)
Description:A0A0D9RHK8
Residue:900
Sequence:
MEVQLGLGRVYPRPPSKTYRGAFQNLFQSVREVIQNPGPRHPEAASAAPPGASLQQQQQQ
QQQQQQQQETSPRQQQKQGEDGSPQAHRRGPTGYLVLDEEQQPSQPQSAPECHPERGCVP
EPGAAVAAGKGLPQQLPAPPDEDDSAAPSTLSLLGPTFPGLSSCSADLKDILSEASTMQL
LQQQQQEAVSEGSSNGRAREASGAPTSSKDNYLGGTSTISDSAKELCKAVSVSMGLGVEA
LEHLSPGEQLRGDCMYAPVLGVPPGVRPIPCAPLAECKGSLLDDSAGKSTEDTVEYSPFK
GGYTKGLEGESLGCSGSAAAGSSGTLELPSTLSLYKSGALDEAAAYQSRDYYNFPLALAG
PPPPPPPPHPHARIKLENPLDYGSAWAAAAAQCRYGDLASLHGAGAAGPGSGSPSAAASS
SWHTLFTAEEGQLYGPCGGGGGGGGGGGGGGAGEAGAVAPYGYTRPPQGLAGQEGDFTAP
DVWYPGGMVSRVPYPSPTCVKSEMGPWMDSYSGPYGDMRLETARDHVLPIDYYFPPQKTC
LICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKC
YEAGMTLGARKLKKLGNLKLQEEGEASSTTSPTEETAQKLTVSHIEGYECQPIFLNVLEA
IEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQY
SWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQI
TPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQL
TKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHTQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM354694
n/a
NameBDBM354694
Synonyms:Preparation of 4-((2S,5S)-5-(hydroxymethyl)-2-(trifluoromethyl)oxazolidin-3-yl)-2-(trifluoromethyl)benzonitrile | US9809583, Example 2
TypeSmall organic molecule
Emp. Form.C21H15F6N3O2
Mol. Mass.455.3531
SMILESFC(F)(F)[C@H]1O[C@H](COCc2ccc(cc2)C#N)CN1c1ccc(C#N)c(c1)C(F)(F)F |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: