Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase Chk1
LigandBDBM2579
Substrate/CompetitorSynthetic Chk1 Peptide Substrate
Meas. Tech.Chk1 Enzymatic Assay
pH7.4±n/a
Temperature310.15±n/a K
Ki 7.8±1.5 nM
CommentsThe apparent Km for ATP in the Chk1 assay was about 120 uM.
Citation Zhao BBower MJMcDevitt PJZhao HDavis STJohanson KOGreen SMConcha NOZhou BB Structural basis for Chk1 inhibition by UCN-01. J Biol Chem 277:46609-15 (2002) [PubMed]  Article
More Info.:Get all data from this article,  Inhibition_Run data,   Solution Info,  Assay Method
 
Serine/threonine-protein kinase Chk1
Name:Serine/threonine-protein kinase Chk1/2
Synonyms:CHK1 checkpoint homolog | Checkpoint kinase-1 (CHK1) | Serine/threonine-protein kinase Chk1
Type:Enzyme Catalytic Domain
Mol. Mass.:54443.02
Organism:Homo sapiens (Human)
Description:gi_166295192
Residue:476
Sequence:
MAVPFVEDWDLVQTLGEGAYGEVQLAVNRVTEEAVAVKIVDMKRAVDCPENIKKEICINK
MLNHENVVKFYGHRREGNIQYLFLEYCSGGELFDRIEPDIGMPEPDAQRFFHQLMAGVVY
LHGIGITHRDIKPENLLLDERDNLKISDFGLATVFRYNNRERLLNKMCGTLPYVAPELLK
RREFHAEPVDVWSCGIVLTAMLAGELPWDQPSDSCQEYSDWKEKKTYLNPWKKIDSAPLA
LLHKILVENPSARITIPDIKKDRWYNKPLKKGAKRPRVTSGGVSESPSGFSKHIQSNLDF
SPVNSASSEENVKYSSSQPEPRTGLSLWDTSPSYIDKLVQGISFSQPTCPDHMLLNSQLL
GTPGSSQNPWQRLVKRMTRFFTKLDADKSYQCLKETCEKLGYQWKKSCMNQVTISTTDRR
NNKLIFKVNLLEMDDKILVDFRLSKGDGLEFKRHFLKIKGKLIDIVSSQKIWLPAT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM2579
Synthetic Chk1 Peptide Substrate
Name:Synthetic Chk1 Peptide Substrate
Synonyms:n/a
Type:Peptide
Mol. Mass.:2323.67
Organism:n/a
Description:A synthetic peptide with a sequence flanking Ser-216 of human Cdc25C.
Residue:20
Sequence:
KVSRSGLYRS PSMPENLNRK