| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Serine protease 1 |
|---|
| Ligand | BDBM17295 |
|---|
| Substrate/Competitor | BDBM17296 |
|---|
| Meas. Tech. | Determination of Inhibition Constants |
|---|
| pH | 8±n/a |
|---|
| Temperature | 310.15±n/a K |
|---|
| Ki | 110±5 nM |
|---|
| Citation |  Nar, H; Bauer, M; Schmid, A; Stassen, JM; Wienen, W; Priepke, HW; Kauffmann, IK; Ries, UJ; Hauel, NH Structural basis for inhibition promiscuity of dual specific thrombin and factor Xa blood coagulation inhibitors. Structure9:29-37 (2001) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Serine protease 1 |
|---|
| Name: | Serine protease 1 |
|---|
| Synonyms: | Beta-Trypsin | Cationic trypsin | PRSS1 | TRP1 | TRY1 | TRY1_BOVIN | TRYP1 | Trypsin | Trypsin I |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 25790.52 |
|---|
| Organism: | Bos taurus (bovine) |
|---|
| Description: | P00760 |
|---|
| Residue: | 246 |
|---|
| Sequence: | MKTFIFLALLGAAVAFPVDDDDKIVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVS
AAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLN
SRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQIT
SNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIK
QTIASN
|
|
|
|---|
| BDBM17295 |
|---|
| BDBM17296 |
|---|
| Name | BDBM17295 |
|---|
| Synonyms: | BIBT0871 | ethyl 2-{[(E)-{[1-(2-{[(4-carbamimidoylphenyl)amino]methyl}-1-methyl-1H-1,3-benzodiazol-5-yl)cyclopropyl](pyridin-2-yl)methylidene}amino]oxy}acetate |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C29H31N7O3 |
|---|
| Mol. Mass. | 525.6015 |
|---|
| SMILES | CCOC(=O)CO\N=C(\c1ccccn1)C1(CC1)c1ccc2n(C)c(CNc3ccc(cc3)C(N)=N)nc2c1 |
|---|
| Structure | 
|
|---|
Search and Browse
