Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetML-IAP-BIR
LigandBDBM17344
Substrate/CompetitorBDBM17342
Meas. Tech.Fluorescence Polarization Affinity Measurements.
pH7.2±n/a
Temperature295.15±n/a K
Ki 40±n/a nM
Citation Zobel KWang LVarfolomeev EFranklin MCElliott LOWallweber HJOkawa DCFlygare JAVucic DFairbrother WJDeshayes K Design, synthesis, and biological activity of a potent Smac mimetic that sensitizes cancer cells to apoptosis by antagonizing IAPs. ACS Chem Biol 1:525-33 (2006) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
ML-IAP-BIR
Name:ML-IAP-BIR
Synonyms:Chimeric protein of melanoma inhibitor of apoptosis protein and XIAP-BIR3 | MLXBIR3SG
Type:Chimeric Protein
Mol. Mass.:19011.07
Organism:Homo sapiens (Human)
Description:Amino acids 160-179 of MLBIR were replaced with amino acids 336-348 of XIAP-BIR3, and Ser150 of MLBIR was mutated to glycine to give MLXBIR3SG.
Residue:172
Sequence:
MGPKDSAKCLHRGPQPSHWAAGDGPTQERCGPRSLGSPVLGLDTCRAWDHVDGQILGQLR
PLTEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQD
KVRCFFCYGGLQSWKRGDDPWTEHAKWFPGCQFLLRSKGQEYINNIHLTHSL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM17344
BDBM17342
NameBDBM17344
Synonyms:(2S)-2-{[(2S)-1-[(2S)-2-[(2S)-2-aminopropanamido]-3-methylbutanoyl]pyrrolidin-2-yl]formamido}-3-(1H-indol-3-yl)propanoic acid | AVPW | L-alanyl-L-valyl-L-prolyl-L-tryptophan
TypePolypeptide
Emp. Form.C24H33N5O5
Mol. Mass.471.5493
SMILESCC(C)[C@H](NC(=O)[C@H](C)N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: