Reaction Details |
| Report a problem with these data |
Target | Complex of Baculoviral IAP repeat-containing protein 7 [1-159,S150G] and E3 ubiquitin-protein ligase XIAP [336-348] |
---|
Ligand | BDBM17346 |
---|
Substrate/Competitor | BDBM17342 |
---|
Meas. Tech. | Fluorescence Polarization Affinity Measurements. |
---|
pH | 7.2±n/a |
---|
Temperature | 295.15±n/a K |
---|
Ki | 190±n/a nM |
---|
Citation | Zobel, K; Wang, L; Varfolomeev, E; Franklin, MC; Elliott, LO; Wallweber, HJ; Okawa, DC; Flygare, JA; Vucic, D; Fairbrother, WJ; Deshayes, K Design, synthesis, and biological activity of a potent Smac mimetic that sensitizes cancer cells to apoptosis by antagonizing IAPs. ACS Chem Biol1:525-33 (2006) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Complex of Baculoviral IAP repeat-containing protein 7 [1-159,S150G] and E3 ubiquitin-protein ligase XIAP [336-348] |
---|
Name: | Complex of Baculoviral IAP repeat-containing protein 7 [1-159,S150G] and E3 ubiquitin-protein ligase XIAP [336-348] |
Synonyms: | Chimeric protein of melanoma inhibitor of apoptosis protein and XIAP-BIR3 | ML-IAP-BIR | MLXBIR3SG |
Type: | Chimeric Protein |
Mol. Mass.: | 19011.07 |
Organism: | Homo sapiens (Human) |
Description: | Amino acids 160-179 of MLBIR were replaced with amino acids 336-348 of XIAP-BIR3, and Ser150 of MLBIR was mutated to glycine to give MLXBIR3SG. |
Residue: | 172 |
Sequence: | MGPKDSAKCLHRGPQPSHWAAGDGPTQERCGPRSLGSPVLGLDTCRAWDHVDGQILGQLR
PLTEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQD
KVRCFFCYGGLQSWKRGDDPWTEHAKWFPGCQFLLRSKGQEYINNIHLTHSL
|
|
|
BDBM17346 |
---|
BDBM17342 |
---|
Name | BDBM17346 |
Synonyms: | (3R,6S,9aS)-2,2-dimethyl-N-(3-methyl-1-phenyl-1H-pyrazol-5-yl)-6-[(2S)-2-(methylamino)propanamido]-5-oxo-octahydroazepino[2,1-b][1,3]thiazole-3-carboxamide | peptide isostere, 9 |
Type | Small organic molecule |
Emp. Form. | C25H34N6O3S |
Mol. Mass. | 498.641 |
SMILES | [H][C@]12CCC[C@H](NC(=O)[C@H](C)NC)C(=O)N1[C@H](C(=O)Nc1cc(C)nn1-c1ccccc1)C(C)(C)S2 |r| |
Structure |
|