| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Baculoviral IAP repeat-containing protein 2 [266-354] |
|---|
| Ligand | BDBM17347 |
|---|
| Substrate/Competitor | BDBM17342 |
|---|
| Meas. Tech. | Fluorescence Polarization Affinity Measurements. |
|---|
| pH | 7.2±n/a |
|---|
| Temperature | 295.15±n/a K |
|---|
| Ki | 110±n/a nM |
|---|
| Citation |  Zobel, K; Wang, L; Varfolomeev, E; Franklin, MC; Elliott, LO; Wallweber, HJ; Okawa, DC; Flygare, JA; Vucic, D; Fairbrother, WJ; Deshayes, K Design, synthesis, and biological activity of a potent Smac mimetic that sensitizes cancer cells to apoptosis by antagonizing IAPs. ACS Chem Biol1:525-33 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Baculoviral IAP repeat-containing protein 2 [266-354] |
|---|
| Name: | Baculoviral IAP repeat-containing protein 2 [266-354] |
|---|
| Synonyms: | API1 | BIRC2 | BIRC2_HUMAN | Chimeric protein of inhibitor of apoptosis protein 2-baculovirus IAP repeat 3 (BIR3) | MIHB | RNF48 | cIAP1-BIR3 | cIAP1-BIR3/XIAP-BIR3 chimeric protein | cIAP1XBIR3 |
|---|
| Type: | Chimeric Protein |
|---|
| Mol. Mass.: | 10496.31 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q13490[266-354] |
|---|
| Residue: | 89 |
|---|
| Sequence: | MQTHAARMRTFMYWPSSVPVQPEQLASAGFYYVGRNDDVKCFCCDGGLRCWESGDDPWVE
HAKWFPRCEFLIRMKGQEFVDEIQGRYPH
|
|
|
|---|
| BDBM17347 |
|---|
| BDBM17342 |
|---|
| Name | BDBM17347 |
|---|
| Synonyms: | (3R,6S,9aR)-N-(3-methyl-1-phenyl-1H-pyrazol-5-yl)-6-[(2S)-2-(methylamino)propanamido]-5-oxo-octahydroazepino[2,1-b][1,3]thiazole-3-carboxamide | peptide isostere, 10 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H30N6O3S |
|---|
| Mol. Mass. | 470.588 |
|---|
| SMILES | [H][C@@]12CCC[C@H](NC(=O)[C@H](C)NC)C(=O)N1[C@@H](CS2)C(=O)Nc1cc(C)nn1-c1ccccc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
