Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMethionine aminopeptidase 2
LigandBDBM17416
Substrate/CompetitorBDBM17353
Meas. Tech.Enzyme Inhibition Assay
Ki 0.5±n/a nM
Citation Marino JPFisher PWHofmann GAKirkpatrick RBJanson CAJohnson RKMa CMattern MMeek TDRyan MDSchulz CSmith WWTew DGTomazek TAVeber DFXiong WCYamamoto YYamashita KYang GThompson SK Highly potent inhibitors of methionine aminopeptidase-2 based on a 1,2,4-triazole pharmacophore. J Med Chem 50:3777-85 (2007) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Methionine aminopeptidase 2
Name:Aminopeptidase
Synonyms:Initiation factor 2-associated 67 kDa glycoprotein | MAP 2 | MetAP 2 | Methionine aminopeptidase 2 (MetAP2) | Methionine aminopeptidases (HsMetAP2) | Peptidase M 2 | p67 | p67eIF2
Type:Enzyme
Mol. Mass.:52884.45
Organism:Homo sapiens (Human)
Description:n/a
Residue:478
Sequence:
MAGVEEVAASGSHLNGDLDPDDREEGAASTAEEAAKKKRRKKKKSKGPSAAGEQEPDKES
GASVDEVARQLERSALEDKERDEDDEDGDGDGDGATGKKKKKKKKKRGPKVQTDPPSVPI
CDLYPNGVFPKGQECEYPPTQDGRTAAWRTTSEEKKALDQASEEIWNDFREAAEAHRQVR
KYVMSWIKPGMTMIEICEKLEDCSRKLIKENGLNAGLAFPTGCSLNNCAAHYTPNAGDTT
VLQYDDICKIDFGTHISGRIIDCAFTVTFNPKYDTLLKAVKDATNTGIKCAGIDVRLCDV
GEAIQEVMESYEVEIDGKTYQVKPIRNLNGHSIGQYRIHAGKTVPIVKGGEATRMEEGEV
YAIETFGSTGKGVVHDDMECSHYMKNFDVGHVPIRLPRTKHLLNVINENFGTLAFCRRWL
DRLGESKYLMALKNLCDLGIVDPYPPLCDIKGSYTAQFEHTILLRPTCKEVVSRGDDY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM17416
BDBM17353
NameBDBM17416
Synonyms:1,2,4-Triazole Compound, 74 | methyl 4-({5-[(3-methylbut-2-en-1-yl)sulfanyl]-4H-1,2,4-triazol-3-yl}amino)benzoate
TypeSmall organic molecule
Emp. Form.C15H18N4O2S
Mol. Mass.318.394
SMILESCOC(=O)c1ccc(Nc2nnc(SCC=C(C)C)[nH]2)cc1 |(-10.52,10.03,;-9.75,8.7,;-8.21,8.7,;-7.44,10.03,;-7.44,7.37,;-8.21,6.03,;-7.44,4.7,;-5.9,4.7,;-4.75,3.67,;-3.29,4.15,;-2.81,5.61,;-1.27,5.61,;-.8,4.15,;.67,3.67,;1.81,4.7,;3.28,4.22,;4.42,5.25,;5.89,4.78,;4.1,6.76,;-2.04,3.24,;-5.13,6.03,;-5.9,7.37,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: