Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMethionine aminopeptidase 2
LigandBDBM17429
Substrate/CompetitorBDBM17353
Meas. Tech.Enzyme Inhibition Assay
Ki 1.7±n/a nM
Citation Marino JPFisher PWHofmann GAKirkpatrick RBJanson CAJohnson RKMa CMattern MMeek TDRyan MDSchulz CSmith WWTew DGTomazek TAVeber DFXiong WCYamamoto YYamashita KYang GThompson SK Highly potent inhibitors of methionine aminopeptidase-2 based on a 1,2,4-triazole pharmacophore. J Med Chem 50:3777-85 (2007) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Methionine aminopeptidase 2
Name:Methionine aminopeptidase 2
Synonyms:Initiation factor 2-associated 67 kDa glycoprotein | MAP 2 | MetAP 2 | Methionine aminopeptidase 2 (MetAP2) | Methionine aminopeptidases (HsMetAP2) | Peptidase M 2 | p67 | p67eIF2
Type:Enzyme
Mol. Mass.:52884.45
Organism:Homo sapiens (Human)
Description:P50579
Residue:478
Sequence:
MAGVEEVAASGSHLNGDLDPDDREEGAASTAEEAAKKKRRKKKKSKGPSAAGEQEPDKES
GASVDEVARQLERSALEDKERDEDDEDGDGDGDGATGKKKKKKKKKRGPKVQTDPPSVPI
CDLYPNGVFPKGQECEYPPTQDGRTAAWRTTSEEKKALDQASEEIWNDFREAAEAHRQVR
KYVMSWIKPGMTMIEICEKLEDCSRKLIKENGLNAGLAFPTGCSLNNCAAHYTPNAGDTT
VLQYDDICKIDFGTHISGRIIDCAFTVTFNPKYDTLLKAVKDATNTGIKCAGIDVRLCDV
GEAIQEVMESYEVEIDGKTYQVKPIRNLNGHSIGQYRIHAGKTVPIVKGGEATRMEEGEV
YAIETFGSTGKGVVHDDMECSHYMKNFDVGHVPIRLPRTKHLLNVINENFGTLAFCRRWL
DRLGESKYLMALKNLCDLGIVDPYPPLCDIKGSYTAQFEHTILLRPTCKEVVSRGDDY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM17429
BDBM17353
NameBDBM17429
Synonyms:1,2,4-Triazole Compound, 87 | N-(5-{[(2-methylphenyl)methyl]sulfanyl}-4H-1,2,4-triazol-3-yl)pyridin-3-amine
TypeSmall organic molecule
Emp. Form.C15H15N5S
Mol. Mass.297.378
SMILESCc1ccccc1CSc1nnc(Nc2cccnc2)[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: