Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMethionine aminopeptidase 2
LigandBDBM17460
Substrate/CompetitorBDBM17353
Meas. Tech.Enzyme Inhibition Assay
pH7.5±n/a
Temperature295.15±n/a K
Ki 3±n/a nM
Citation Kallander LSLu QChen WTomaszek TYang GTew DMeek TDHofmann GASchulz-Pritchard CKSmith WWJanson CARyan MDZhang GFJohanson KOKirkpatrick RBHo TFFisher PWMattern MRJohnson RKHansbury MJWinkler JDWard KWVeber DFThompson SK 4-Aryl-1,2,3-triazole: a novel template for a reversible methionine aminopeptidase 2 inhibitor, optimized to inhibit angiogenesis in vivo. J Med Chem 48:5644-7 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Inhibition_Run data,   Solution Info,  Assay Method
 
Methionine aminopeptidase 2
Name:Methionine aminopeptidase 2
Synonyms:Initiation factor 2-associated 67 kDa glycoprotein | MAP 2 | MetAP 2 | Methionine aminopeptidase 2 (MetAP2) | Methionine aminopeptidases (HsMetAP2) | Peptidase M 2 | p67 | p67eIF2
Type:Enzyme
Mol. Mass.:52884.45
Organism:Homo sapiens (Human)
Description:P50579
Residue:478
Sequence:
MAGVEEVAASGSHLNGDLDPDDREEGAASTAEEAAKKKRRKKKKSKGPSAAGEQEPDKES
GASVDEVARQLERSALEDKERDEDDEDGDGDGDGATGKKKKKKKKKRGPKVQTDPPSVPI
CDLYPNGVFPKGQECEYPPTQDGRTAAWRTTSEEKKALDQASEEIWNDFREAAEAHRQVR
KYVMSWIKPGMTMIEICEKLEDCSRKLIKENGLNAGLAFPTGCSLNNCAAHYTPNAGDTT
VLQYDDICKIDFGTHISGRIIDCAFTVTFNPKYDTLLKAVKDATNTGIKCAGIDVRLCDV
GEAIQEVMESYEVEIDGKTYQVKPIRNLNGHSIGQYRIHAGKTVPIVKGGEATRMEEGEV
YAIETFGSTGKGVVHDDMECSHYMKNFDVGHVPIRLPRTKHLLNVINENFGTLAFCRRWL
DRLGESKYLMALKNLCDLGIVDPYPPLCDIKGSYTAQFEHTILLRPTCKEVVSRGDDY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM17460
BDBM17353
NameBDBM17460
Synonyms:1,2,3-triazole analogue, 16 | 5-(4-bromophenyl)-1H-1,2,3-triazole
TypeSmall organic molecule
Emp. Form.C8H6BrN3
Mol. Mass.224.057
SMILESBrc1ccc(cc1)-c1c[nH]nn1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: