| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Aldo-keto reductase family 1 member C3 |
|---|
| Ligand | BDBM17638 |
|---|
| Substrate/Competitor | BDBM17639 |
|---|
| Meas. Tech. | Androsterone Reduction Inhibition Assay |
|---|
| pH | 7±n/a |
|---|
| Temperature | 303.15±n/a K |
|---|
| Ki | 2100±400 nM |
|---|
| Km | 15900±400 nM |
|---|
| Comments | Mixed type inhibition. |
|---|
| Citation |  Lovering, AL; Ride, JP; Bunce, CM; Desmond, JC; Cummings, SM; White, SA Crystal structures of prostaglandin D(2) 11-ketoreductase (AKR1C3) in complex with the nonsteroidal anti-inflammatory drugs flufenamic acid and indomethacin. Cancer Res64:1802-10 (2004) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Aldo-keto reductase family 1 member C3 |
|---|
| Name: | Aldo-keto reductase family 1 member C3 |
|---|
| Synonyms: | 17-beta-Hydroxysteroid Dehydrogenase 5 (17-beta-HSD5, AKR1C3) | 3-alpha-HSD type 2 | AK1C3_HUMAN | AKR1C3 | Aldo-keto reductase family 1 member C3 | Aldo-keto reductase family 1 member C3 (AK1C3) | Aldo-keto reductase family 1 member C3 (AK1C3a) | Aldo-keto reductase family 1 member C3 (AKR1C3) | Aldo-keto-reductase family 1 member C3 | DDH1 | Dihydrodiol dehydrogenase 3 | Dihydrodiol dehydrogenase type I | Estradiol 17-beta-dehydrogenase | HSD17B5 | KIAA0119 | PGFS | Prostaglandin F synthase | Testosterone 17-beta-dehydrogenase 5 | Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 36859.86 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P42330 |
|---|
| Residue: | 323 |
|---|
| Sequence: | MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQ
VGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPM
SLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKP
GLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPV
LCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLD
RNLHYFNSDSFASHPNYPYSDEY
|
|
|
|---|
| BDBM17638 |
|---|
| BDBM17639 |
|---|
| Name | BDBM17638 |
|---|
| Synonyms: | 2-{1-[(4-chlorophenyl)carbonyl]-5-methoxy-2-methyl-1H-indol-3-yl}acetic acid | CHEMBL6 | Indocin | Indomethacin | US11478464, Compound Indomethacin | US11786535, Compound Indomethacin | US9271961, Indomethacin | indometacin |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H16ClNO4 |
|---|
| Mol. Mass. | 357.788 |
|---|
| SMILES | COc1ccc2n(C(=O)c3ccc(Cl)cc3)c(C)c(CC(O)=O)c2c1 |
|---|
| Structure | 
|
|---|
Search and Browse
