Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGlutamate Carboxypeptidase II (GCPII)
LigandBDBM17660
Substrate/CompetitorBDBM17658
Meas. Tech.Determination of Inhibition Concentration Values (IC50)
pH7.4±n/a
Temperature310.15±n/a K
IC50 9500±n/a nM
Citation Barinka CRovenská MMlcochová PHlouchová KPlechanovová AMajer PTsukamoto TSlusher BSKonvalinka JLubkowski J Structural insight into the pharmacophore pocket of human glutamate carboxypeptidase II. J Med Chem 50:3267-73 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Inhibition_Run data,   Solution Info,  Assay Method
 
Glutamate Carboxypeptidase II (GCPII)
Name:Glutamate Carboxypeptidase II (GCPII)
Synonyms:Folate hydrolase 1 | Folylpoly-gamma-glutamate carboxypeptidase | Glutamate carboxypeptidase 2 | Membrane glutamate carboxypeptidase | Prostate-specific membrane antigen | Prostate-specific membrane antigen (PSMA) | Pteroylpoly-gamma-glutamate carboxypeptidase | mGCP
Type:Enzyme
Mol. Mass.:79524.51
Organism:Homo sapiens (Human)
Description:The extracellular domain of human glutamate carboxypeptidase II (rhGCPII, amino acids 44-750) was overexpressed in Drosophila Schneider S2 cells and purified to homogeneity.
Residue:707
Sequence:
KSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEF
GLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSA
FSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAK
GVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGI
AEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVK
MHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFG
TLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLR
VDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEV
FFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGM
VFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIA
SKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGE
SFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM17660
BDBM17658
NameBDBM17660
Synonyms:(2S)-2-amino-3-(3,5-dioxo-1,2,4-oxadiazolidin-2-yl)propanoic acid | 2-amino-3-(3,5-dioxo[1,2,4]oxadiazolidin-2-yl)propionic acid | CHEMBL279956 | Quisqualate | Quisqualate, L | quisqualic acid
TypeSmall organic molecule
Emp. Form.C5H7N3O5
Mol. Mass.189.1262
SMILESN[C@@H](Cn1oc(=O)[nH]c1=O)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: