Reaction Details |
| Report a problem with these data |
Target | Proto-oncogene tyrosine-protein kinase Src |
---|
Ligand | BDBM17697 |
---|
Substrate/Competitor | biotinylated gastrin substrate |
---|
Meas. Tech. | HTRF Kinase Inhibition Assay |
---|
pH | 7.5±n/a |
---|
Temperature | 295.15±n/a K |
---|
IC50 | 720±n/a nM |
---|
Citation | Potashman, MH; Bready, J; Coxon, A; Demelfi, TM; Dipietro, L; Doerr, N; Elbaum, D; Estrada, J; Gallant, P; Germain, J; Gu, Y; Harmange, JC; Kaufman, SA; Kendall, R; Kim, JL; Kumar, GN; Long, AM; Neervannan, S; Patel, VF; Polverino, A; Rose, P; Plas, SV; Whittington, D; Zanon, R; Zhao, H Design, Synthesis, and Evaluation of Orally Active Benzimidazoles and Benzoxazoles as Vascular Endothelial Growth Factor-2 Receptor Tyrosine Kinase Inhibitors. J Med Chem50:4351-4373 (2007) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Proto-oncogene tyrosine-protein kinase Src |
---|
Name: | Proto-oncogene tyrosine-protein kinase Src |
Synonyms: | Calmodulin/Proto-oncogene tyrosine-protein kinase Src | Protein cereblon/Tyrosine-protein kinase SRC | Proto-oncogene c-Src | Proto-oncogene tyrosine-protein kinase Src (c-Src) | SRC | SRC1 | SRC_HUMAN | Tyrosine-protein kinase Src (SRC) | V-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian) | c-Src | p60-Src | pp60c-src |
Type: | Protein |
Mol. Mass.: | 59838.60 |
Organism: | Homo sapiens (Human) |
Description: | P12931 |
Residue: | 536 |
Sequence: | MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAE
PKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGD
WWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRES
ETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGL
CHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTL
KPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGETGKY
LRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYT
ARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVER
GYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
|
|
|
BDBM17697 |
---|
biotinylated gastrin substrate |
---|
Name: | biotinylated gastrin substrate |
Synonyms: | n/a |
Type: | Peptide |
Mol. Mass.: | 2100.22 |
Organism: | n/a |
Description: | n/a |
Residue: | 17 |
Sequence: | |