Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosine-protein kinase TXK
LigandBDBM357013
Substrate/Competitorn/a
Meas. Tech.Caliper Kinase Assay
IC50 50000±n/a nM
Citation Lloyd JFinlay HGunaga PBanerjee AAdisechan A Quinazolines as potassium ion channel inhibitors US Patent  US10214511 Publication Date 2/26/2019
More Info.:Get all data from this article,  Assay Method
 
Tyrosine-protein kinase TXK
Name:Tyrosine-protein kinase TXK
Synonyms:PTK4 | Protein-tyrosine kinase 4 | RLK | Resting lymphocyte kinase | TXK | Tyrosine-protein kinase TXK (TXK)
Type:Protein
Mol. Mass.:61268.80
Organism:Homo sapiens (Human)
Description:P42681
Residue:527
Sequence:
MILSSYNTIQSVFCCCCCCSVQKRQMRTQISLSTDEELPEKYTQRRRPWLSQLSNKKQSN
TGRVQPSKRKPLPPLPPSEVAEEKIQVKALYDFLPREPCNLALRRAEEYLILEKYNPHWW
KARDRLGNEGLIPSNYVTENKITNLEIYEWYHRNITRNQAEHLLRQESKEGAFIVRDSRH
LGSYTISVFMGARRSTEAAIKHYQIKKNDSGQWYVAERHAFQSIPELIWYHQHNAAGLMT
RLRYPVGLMGSCLPATAGFSYEKWEIDPSELAFIKEIGSGQFGVVHLGEWRSHIQVAIKA
INEGSMSEEDFIEEAKVMMKLSHSKLVQLYGVCIQRKPLYIVTEFMENGCLLNYLRENKG
KLRKEMLLSVCQDICEGMEYLERNGYIHRDLAARNCLVSSTCIVKISDFGMTRYVLDDEY
VSSFGAKFPIKWSPPEVFLFNKYSSKSDVWSFGVLMWEVFTEGKMPFENKSNLQVVEAIS
EGFRLYRPHLAPMSIYEVMYSCWHEKPEGRPTFAELLRAVTEIAETW
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM357013
n/a
NameBDBM357013
Synonyms:5-Phenyl-N-(pyridin-2-ylmethyl)-2-(pyrimidin-5-yl)quinazolin-4-amine | US10214511, Example 1
TypeSmall organic molecule
Emp. Form.C42H30N10O
Mol. Mass.690.754
SMILESOc1nc(nc2cccc(-c3ccccc3)c12)-c1cncnc1.C(Nc1nc(nc2cccc(-c3ccccc3)c12)-c1cncnc1)c1ccccn1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: