Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCoagulation factor XI
LigandBDBM357140
Substrate/Competitorn/a
Meas. Tech.Factor XIa Assay
Ki 0.170±n/a nM
Citation Xu JAli AZhou WGao YEdmondson SDMertz ENeelamkavil SFLiu WSun WShen DHarper BZhu CBara TLim YYang M Factor XIA inhibitors US Patent  US10214512 Publication Date 2/26/2019
More Info.:Get all data from this article,  Assay Method
 
Coagulation factor XI
Name:Coagulation factor XI
Synonyms:Coagulation factor XIa | Coagulation factor XIa heavy chain | Coagulation factor XIa light chain | F11 | FXI | Factor XIa | Factor XIa (fXIa) | PTA | Plasma thromboplastin antecedent
Type:Enzyme
Mol. Mass.:70130.58
Organism:Homo sapiens (Human)
Description:P03951
Residue:625
Sequence:
MIFLYQVVHFILFTSVSGECVTQLLKDTCFEGGDITTVFTPSAKYCQVVCTYHPRCLLFT
FTAESPSEDPTRWFTCVLKDSVTETLPRVNRTAAISGYSFKQCSHQISACNKDIYVDLDM
KGINYNSSVAKSAQECQERCTDDVHCHFFTYATRQFPSLEHRNICLLKHTQTGTPTRITK
LDKVVSGFSLKSCALSNLACIRDIFPNTVFADSNIDSVMAPDAFVCGRICTHHPGCLFFT
FFSQEWPKESQRNLCLLKTSESGLPSTRIKKSKALSGFSLQSCRHSIPVFCHSSFYHDTD
FLGEELDIVAAKSHEACQKLCTNAVRCQFFTYTPAQASCNEGKGKCYLKLSSNGSPTKIL
HGRGGISGYTLRLCKMDNECTTKIKPRIVGGTASVRGEWPWQVTLHTTSPTQRHLCGGSI
IGNQWILTAAHCFYGVESPKILRVYSGILNQSEIKEDTSFFGVQEIIIHDQYKMAESGYD
IALLKLETTVNYTDSQRPICLPSKGDRNVIYTDCWVTGWGYRKLRDKIQNTLQKAKIPLV
TNEECQKRYRGHKITHKMICAGYREGGKDACKGDSGGPLSCKHNEVWHLVGITSWGEGCA
QRERPGVYTNVVEYVDWILEKTQAV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM357140
n/a
NameBDBM357140
Synonyms:(Z)-5-(5-chloro-2-(trifluoromethoxy)phenyl)-2-(24-((methoxycarbonyl)amino)-4-oxo-11H-3-aza-1(4,2)-imidazola-2(1,2) -benzenacyclononaphane-9-yl)pyridine 1-oxide | US10214512, Example 99-a
TypeSmall organic molecule
Emp. Form.C29H25ClF3N5O5
Mol. Mass.615.988
SMILESCOC(=O)Nc1ccc2-c3c[nH]c(n3)C(CCCCC(=O)Nc2c1)c1ccc(c[n+]1[O-])-c1cc(Cl)ccc1OC(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: