Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetKallikrein 1
LigandBDBM357026
Substrate/Competitorn/a
Meas. Tech.Kallikrein Assay
Ki 0.290±n/a nM
Citation Xu JAli AZhou WGao YEdmondson SDMertz ENeelamkavil SFLiu WSun WShen DHarper BZhu CBara TLim YYang M Factor XIA inhibitors US Patent  US10214512 Publication Date 2/26/2019
More Info.:Get all data from this article,  Assay Method
 
Kallikrein 1
Name:Kallikrein 1
Synonyms:Kallikrein 1 | Kallikrein-1 | Kidney/pancreas/salivary gland kallikrein | Tissue kallikrein
Type:Enzyme
Mol. Mass.:28874.69
Organism:Homo sapiens (Human)
Description:P06870
Residue:262
Sequence:
MWFLVLCLALSLGGTGAAPPIQSRIVGGWECEQHSQPWQAALYHFSTFQCGGILVHRQWV
LTAAHCISDNYQLWLGRHNLFDDENTAQFVHVSESFPHPGFNMSLLENHTRQADEDYSHD
LMLLRLTEPADTITDAVKVVELPTEEPEVGSTCLASGWGSIEPENFSFPDDLQCVDLKIL
PNDECKKAHVQKVTDFMLCVGHLEGGKDTCVGDSGGPLMCDGVLQGVTSWGYVPCGTPNK
PSVAVRVLSYVKWIEDTIAENS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM357026
n/a
NameBDBM357026
Synonyms:5-(5-Chloro-2-(1H-tetrazol-1-yl)phenyl)-2-(24-((methoxycarbonyl)amino)-4-oxo-3-aza-1(1,3),2(1,2) -dibenzenacyclononaphane-9-yl)pyridine 1-oxide | US10214512, Example 6-a
TypeSmall organic molecule
Emp. Form.C32H28ClN7O4
Mol. Mass.610.062
SMILESCOC(=O)Nc1ccc-2c(NC(=O)CCCCC(c3cccc-2c3)c2ccc(c[n+]2[O-])-c2cc(Cl)ccc2-n2cnnn2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: