| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dimer of Gag-Pol polyprotein [491-589,Q498K,L501I,G539V,I545V,V555I,V573A] |
|---|
| Ligand | BDBM519 |
|---|
| Substrate/Competitor | HIV-1 Protease Substrate |
|---|
| Meas. Tech. | Enzyme Inhibition Assay |
|---|
| Ki | 89.53±n/a nM |
|---|
| Citation |  Reddy, GS; Ali, A; Nalam, MN; Anjum, SG; Cao, H; Nathans, RS; Schiffer, CA; Rana, TM Design and Synthesis of HIV-1 Protease Inhibitors Incorporating Oxazolidinones as P2/P2' Ligands in Pseudosymmetric Dipeptide Isosteres. J Med Chem50:4316-28 (2007) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Dimer of Gag-Pol polyprotein [491-589,Q498K,L501I,G539V,I545V,V555I,V573A] |
|---|
| Name: | Dimer of Gag-Pol polyprotein [491-589,Q498K,L501I,G539V,I545V,V555I,V573A] |
|---|
| Synonyms: | HIV-1 Protease Mutant M1 (L10I, G48V, I54V, L63P, V82A) |
|---|
| Type: | Protein Complex |
|---|
| Mol. Mass.: | n/a |
|---|
| Description: | n/a |
|---|
| Components: | This complex has 2 components. |
|---|
| Component 1 |
| Name: | Gag-Pol polyprotein [491-589,Q498K,L501I,G539V,I545V,V555I,V573A] |
|---|
| Synonyms: | HIV-1 Protease Mutant M1 (Q7K,L10I, G48V, I54V, V63I, V82A) chain A | HIV-1 Protease Mutant M1 (Q7K,L10I, G48V, I54V, V63I, V82A) chain B | POL_HV1A2 | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10807.22 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P03369[491-589,Q498K,L501I,G539V,I545V,V555I,V573A] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQITLWKRPIVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIVGIGGFVKVRQYD
QIPIEICGHKAIGTVLVGPTPANIIGRNLLTQIGCTLNF
|
|
|
|---|
| Component 2 |
| Name: | Gag-Pol polyprotein [491-589,Q498K,L501I,G539V,I545V,V555I,V573A] |
|---|
| Synonyms: | HIV-1 Protease Mutant M1 (Q7K,L10I, G48V, I54V, V63I, V82A) chain A | HIV-1 Protease Mutant M1 (Q7K,L10I, G48V, I54V, V63I, V82A) chain B | POL_HV1A2 | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10807.22 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P03369[491-589,Q498K,L501I,G539V,I545V,V555I,V573A] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQITLWKRPIVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIVGIGGFVKVRQYD
QIPIEICGHKAIGTVLVGPTPANIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM519 |
|---|
| HIV-1 Protease Substrate |
|---|
| Name: | HIV-1 Protease Substrate |
|---|
| Synonyms: | n/a |
|---|
| Type: | Peptide |
|---|
| Mol. Mass.: | 4728.18 |
|---|
| Organism: | n/a |
|---|
| Description: | n/a |
|---|
| Residue: | 44 |
|---|
| Sequence: | Arg-Glu(EDANS)-Ser-Gln-Asn-Tyr-Pro-Ile-Val-Gln-Lys(DABCYL)-
Arg
|
|
|
|---|
Search and Browse
