Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHIV-1 Protease Mutant M2 (D30N, L63P, N88D)
LigandBDBM520
Substrate/CompetitorHIV-1 Protease Substrate
Meas. Tech.Enzyme Inhibition Assay
Ki 0.46±n/a nM
Citation Reddy GSAli ANalam MNAnjum SGCao HNathans RSSchiffer CARana TM Design and Synthesis of HIV-1 Protease Inhibitors Incorporating Oxazolidinones as P2/P2' Ligands in Pseudosymmetric Dipeptide Isosteres. J Med Chem 50:4316-28 (2007) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
HIV-1 Protease Mutant M2 (D30N, L63P, N88D)
Name:HIV-1 Protease Mutant M2 (D30N, L63P, N88D)
Synonyms:n/a
Type:Protein Complex
Mol. Mass.:n/a
Description:n/a
Components:This complex has 2 components.
Component 1
Name:HIV-1 Protease Mutant M2 (D30N, L63P, N88D) chain A
Synonyms:HIV-1 Protease Mutant M2 (D30N, L63P, N88D) chain B
Type:Enzyme Subunit
Mol. Mass.:10807.22
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:99
Sequence:
PQITLWKRPLVTIRIGGQLKEALLDTGADNTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRDLLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:HIV-1 Protease Mutant M2 (D30N, L63P, N88D) chain A
Synonyms:HIV-1 Protease Mutant M2 (D30N, L63P, N88D) chain B
Type:Enzyme Subunit
Mol. Mass.:10807.22
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:99
Sequence:
PQITLWKRPLVTIRIGGQLKEALLDTGADNTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRDLLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM520
HIV-1 Protease Substrate
Name:HIV-1 Protease Substrate
Synonyms:n/a
Type:Peptide
Mol. Mass.:4728.18
Organism:n/a
Description:n/a
Residue:44
Sequence:
Arg-Glu(EDANS)-Ser-Gln-Asn-Tyr-Pro-Ile-Val-Gln-Lys(DABCYL)-

Arg