Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFibroblast growth factor receptor
LigandBDBM357253
Substrate/Competitorn/a
Meas. Tech.Determination of the Effects of the Compounds of the Present Invention on FGFR Kinase Activity
IC50 6.80±n/a nM
Citation Chen LGuan DBai HYan XMiao SZhu S Substituted pyrazoles as inhibitors of fibroblast growth factor receptor US Patent  US10214515 Publication Date 2/26/2019
More Info.:Get all data from this article,  Assay Method
 
Fibroblast growth factor receptor
Name:Fibroblast growth factor receptor
Synonyms:CD_antigen: CD333 | FGFR-3 | FGFR3 | Fibroblast growth factor receptor 3 (FGFR3) | JTK4
Type:Protein
Mol. Mass.:87699.57
Organism:Homo sapiens (Human)
Description:P22607
Residue:806
Sequence:
MGAPACALALCVAVAIVAGASSESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELS
CPPPGGGPMGPTVWVKDGTGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQRVLCH
FSVRVTDAPSSGDDEDGEDEAEDTGVDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAG
NPTPSISWLKNGREFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQT
YTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGP
DGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAE
EELVEADEAGSVYAGILSYGVGFFLFILVVAAVTLCRLRSPPKKGLGSPTVHKISRFPLK
RQVSLESNASMSSNTPLVRIARLSSGEGPTLANVSELELPADPKWELSRARLTLGKPLGE
GCFGQVVMAEAIGIDKDRAAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNIIN
LLGACTQGGPLYVLVEYAAKGNLREFLRARRPPGLDYSFDTCKPPEEQLTFKDLVSCAYQ
VARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKKTTNGRLPVKW
MAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCT
HDLYMIMRECWHAAPSQRPTFKQLVEDLDRVLTVTSTDEYLDLSAPFEQYSPGGQDTPSS
SSSGDDSVFAHDLLPPAPPSSGGSRT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM357253
n/a
NameBDBM357253
Synonyms:(5-Amino-1-(2-cyclopropyl-1H-benzo[d]imidazol-5-yl)-1H-pyrazol-4-yl)(6-(1-ethyl-1H-pyrazol-4-yl)-1H-indol-2-yl)methanone | US10214515, Example 16
TypeSmall organic molecule
Emp. Form.C27H24N8O
Mol. Mass.476.5325
SMILESCCn1cc(cn1)-c1ccc2cc([nH]c2c1)C(=O)c1cnn(c1N)-c1ccc2[nH]c(nc2c1)C1CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: