Reaction Details |
| Report a problem with these data |
Target | Dihydrofolate reductase [F98Y] |
---|
Ligand | BDBM18069 |
---|
Substrate/Competitor | BDBM18044 |
---|
Meas. Tech. | Enzyme Inhibition Assay |
---|
pH | 7±n/a |
---|
Temperature | 303.15±n/a K |
---|
Ki | 5500±n/a nM |
---|
IC50 | 45000±14000 nM |
---|
Comments | MIC=0.06 ug/mL. |
---|
Citation | MUKHIJA, S; BANDERA, M; PARISI, S; RIGO, S; LIEB, S; LOCIURO, S; GILLESSEN, D; ISLAM, K AR-709-An Investigational diaminopyrimidine: Inhibition, Binding and Mode of Action. Interscience Conference on Antimicrobial Agents in Chemotherapy0:1-1 (2006) |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Dihydrofolate reductase [F98Y] |
---|
Name: | Dihydrofolate reductase [F98Y] |
Synonyms: | DYR_STAAU | Dihydrofolate Reductase (DHFR) Mutant (F98Y) | Tetrahydrofolate dehydrogenase | folA |
Type: | Enzyme |
Mol. Mass.: | 18265.71 |
Organism: | Staphylococcus aureus (subsp. aureus NCTC 8325) |
Description: | P0A017[F98Y] |
Residue: | 159 |
Sequence: | MTLSILVAHDLQRVIGFENQLPWHLPNDLKHVKKLSTGHTLVMGRKTFESIGKPLPNRRN
VVLTSDTSFNVEGVDVIHSIEDIYQLPGHVFIFGGQTLYEEMIDKVDDMYITVIEGKFRG
DTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRKK
|
|
|
BDBM18069 |
---|
BDBM18044 |
---|
Name | BDBM18069 |
Synonyms: | 5-[(3,4,5-trimethoxyphenyl)methyl]pyrimidine-2,4-diamine | CHEMBL22 | TMP | Trimethoprim | Trimethoprim (TMP) | US10870625, Compound TMP |
Type | Small organic molecule |
Emp. Form. | C14H18N4O3 |
Mol. Mass. | 290.3177 |
SMILES | COc1cc(Cc2cnc(N)nc2N)cc(OC)c1OC |
Structure |
|