| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase [F98Y] |
|---|
| Ligand | BDBM18069 |
|---|
| Substrate/Competitor | BDBM18044 |
|---|
| Meas. Tech. | Enzyme Inhibition Assay |
|---|
| pH | 7±n/a |
|---|
| Temperature | 303.15±n/a K |
|---|
| Ki | 5500±n/a nM |
|---|
| IC50 | 45000±14000 nM |
|---|
| Comments | MIC=0.06 ug/mL. |
|---|
| Citation |  MUKHIJA, S; BANDERA, M; PARISI, S; RIGO, S; LIEB, S; LOCIURO, S; GILLESSEN, D; ISLAM, K AR-709-An Investigational diaminopyrimidine: Inhibition, Binding and Mode of Action. Interscience Conference on Antimicrobial Agents in Chemotherapy0:1-1 (2006) |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Dihydrofolate reductase [F98Y] |
|---|
| Name: | Dihydrofolate reductase [F98Y] |
|---|
| Synonyms: | DYR_STAAU | Dihydrofolate Reductase (DHFR) Mutant (F98Y) | Tetrahydrofolate dehydrogenase | folA |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 18265.71 |
|---|
| Organism: | Staphylococcus aureus (subsp. aureus NCTC 8325) |
|---|
| Description: | P0A017[F98Y] |
|---|
| Residue: | 159 |
|---|
| Sequence: | MTLSILVAHDLQRVIGFENQLPWHLPNDLKHVKKLSTGHTLVMGRKTFESIGKPLPNRRN
VVLTSDTSFNVEGVDVIHSIEDIYQLPGHVFIFGGQTLYEEMIDKVDDMYITVIEGKFRG
DTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRKK
|
|
|
|---|
| BDBM18069 |
|---|
| BDBM18044 |
|---|
| Name | BDBM18069 |
|---|
| Synonyms: | 5-[(3,4,5-trimethoxyphenyl)methyl]pyrimidine-2,4-diamine | CHEMBL22 | TMP | Trimethoprim | Trimethoprim (TMP) | US10870625, Compound TMP |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H18N4O3 |
|---|
| Mol. Mass. | 290.3177 |
|---|
| SMILES | COc1cc(Cc2cnc(N)nc2N)cc(OC)c1OC |
|---|
| Structure | 
|
|---|
Search and Browse
