Reaction Details |
| Report a problem with these data |
Target | Cathepsin D |
---|
Ligand | BDBM50012660 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | In Vitro Enzymatic |
---|
pH | 3.5±n/a |
---|
IC50 | 240000±n/a nM |
---|
Comments | extracted |
---|
Citation | Lewis, RT; Allen, JR; Cheng, Y; Choquette, D; Epstein, O; Guzman-Perez, A; Harrington, PE; Hua, Z; Hungate, RW; Human, JB; Judd, T; Liu, Q; Lopez, P; Minatti, AE; Olivieri, P; Romero, K; Rumfelt, S; Rzasa, RM; Schenkel, L; Stellwagen, J; White, R; Xue, Q; Zheng, XM; Zhong, W Amino-dihydrothiazine and amino-dioxido dihydrothiazine compounds as beta-secretase antagonists and methods of use US Patent US9556135 Publication Date 1/31/2017 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Cathepsin D |
---|
Name: | Cathepsin D |
Synonyms: | CATD_HUMAN | CPSD | CTSD | Cathepsin D [Precursor] | Cathepsin D heavy chain | Cathepsin D light chain | Cathepsin D precursor |
Type: | Enzyme |
Mol. Mass.: | 44551.72 |
Organism: | Homo sapiens (Human) |
Description: | Human proCathepsin D (SwissProt accession number P07339) was expressed in Sf9 cells, purified, and autoactivated. |
Residue: | 412 |
Sequence: | MQPSSLLPLALCLLAAPASALVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVP
AVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIH
HKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFG
EATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQ
PGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSL
MVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQ
AGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL
|
|
|
BDBM50012660 |
---|
n/a |
---|
Name | BDBM50012660 |
Synonyms: | CHEMBL3261078 | US9273042, 5 | US9556135, 19 |
Type | Small organic molecule |
Emp. Form. | C19H20ClFN4O3S |
Mol. Mass. | 438.904 |
SMILES | CC1(C)C(N)=N[C@@](C)(CS1(=O)=O)c1cc(NC(=O)c2ccc(Cl)cn2)ccc1F |r,c:4| |
Structure |
|