| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cathepsin D |
|---|
| Ligand | BDBM230002 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | In Vitro Enzymatic |
|---|
| pH | 3.5±n/a |
|---|
| IC50 | 63900±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Lewis, RT; Allen, JR; Cheng, Y; Choquette, D; Epstein, O; Guzman-Perez, A; Harrington, PE; Hua, Z; Hungate, RW; Human, JB; Judd, T; Liu, Q; Lopez, P; Minatti, AE; Olivieri, P; Romero, K; Rumfelt, S; Rzasa, RM; Schenkel, L; Stellwagen, J; White, R; Xue, Q; Zheng, XM; Zhong, W Amino-dihydrothiazine and amino-dioxido dihydrothiazine compounds as beta-secretase antagonists and methods of use US Patent US9556135 Publication Date 1/31/2017 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cathepsin D |
|---|
| Name: | Cathepsin D |
|---|
| Synonyms: | CATD_HUMAN | CPSD | CTSD | Cathepsin D [Precursor] | Cathepsin D heavy chain | Cathepsin D light chain | Cathepsin D precursor |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 44551.72 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Human proCathepsin D (SwissProt accession number P07339) was expressed in Sf9 cells, purified, and autoactivated. |
|---|
| Residue: | 412 |
|---|
| Sequence: | MQPSSLLPLALCLLAAPASALVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVP
AVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIH
HKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFG
EATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQ
PGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSL
MVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQ
AGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL
|
|
|
|---|
| BDBM230002 |
|---|
| n/a |
|---|
| Name | BDBM230002 |
|---|
| Synonyms: | US9556135, 190 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H21ClFN5O2S |
|---|
| Mol. Mass. | 485.962 |
|---|
| SMILES | CC1(C)C(N)=N[C@@](C)(CS1(=O)=O)c1cc(Nc2ncc(C#C)c3cc(Cl)cnc23)ccc1F |r,c:4| |
|---|
| Structure | 
|
|---|
Search and Browse
