Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetThymidylate Synthase (TS)
LigandBDBM18768
Substrate/CompetitorBDBM18754
Meas. Tech.Thymidylate Synthase (TS) Assay
pH7.4±n/a
Temperature293.15±n/a K
Ki 900±n/a nM
CommentsCompound showed null or very low toxicity in the cytotoxicity test against gram-positive and gram-negative wild-type bacterial strains.It showed good activity against most of the multi-resistant strains tested, in particular against Staphylococcus epidermidis.
Citation Costi MPGelain ABarlocco DGhelli SSoragni FReniero FRossi TRuberto AGuillou CCavazzuti ACasolari CFerrari S Antibacterial agent discovery using thymidylate synthase biolibrary screening. J Med Chem 49:5958-68 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Inhibition_Run data,   Solution Info,  Assay Method
 
Thymidylate Synthase (TS)
Name:Thymidylate synthase
Synonyms:TSase | Thymidylate synthase
Type:Enzyme
Mol. Mass.:36576.54
Organism:Lactobacillus casei
Description:n/a
Residue:316
Sequence:
MLEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFGHQMRFDLSKGFPLLTTKKVPFGLIKSE
LLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHE
EMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWHTSKGDTIDQLGDVIEQIKTHPYSRRL
IVSAWNPEDVPTMALPPCHTLYQFYVNDGKLSLQLYQRSADIFLGVPFNIASYALLTHLV
AHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDKHDIFDFDMKDIK
LLNYDPYPAIKAPVAV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM18768
BDBM18754
NameBDBM18768
Synonyms:1,8-naphthalein derivative, 15 | 4,4-bis(3,5-dibromo-4-hydroxyphenyl)-3-oxatricyclo[7.3.1.0^{5,13}]trideca-1(12),5,7,9(13),10-pentaen-2-one
TypeSmall organic molecule
Emp. Form.C24H12Br4O4
Mol. Mass.683.966
SMILESOc1c(Br)cc(cc1Br)C1(OC(=O)c2cccc3cccc1c23)c1cc(Br)c(O)c(Br)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: