| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Thymidylate synthase |
|---|
| Ligand | BDBM18769 |
|---|
| Substrate/Competitor | BDBM18754 |
|---|
| Meas. Tech. | Thymidylate Synthase (TS) Assay |
|---|
| pH | 7.4±n/a |
|---|
| Temperature | 293.15±n/a K |
|---|
| Ki | 1600±n/a nM |
|---|
| Comments | Ki has been reported. |
|---|
| Citation |  Costi, MP; Gelain, A; Barlocco, D; Ghelli, S; Soragni, F; Reniero, F; Rossi, T; Ruberto, A; Guillou, C; Cavazzuti, A; Casolari, C; Ferrari, S Antibacterial agent discovery using thymidylate synthase biolibrary screening. J Med Chem49:5958-68 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
|---|
| |
| Thymidylate synthase |
|---|
| Name: | Thymidylate synthase |
|---|
| Synonyms: | TSase | TYSY_LACCA | Thymidylate Synthase (TS) | Thymidylate synthase | thyA |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 36576.54 |
|---|
| Organism: | Lactobacillus casei |
|---|
| Description: | n/a |
|---|
| Residue: | 316 |
|---|
| Sequence: | MLEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFGHQMRFDLSKGFPLLTTKKVPFGLIKSE
LLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHE
EMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWHTSKGDTIDQLGDVIEQIKTHPYSRRL
IVSAWNPEDVPTMALPPCHTLYQFYVNDGKLSLQLYQRSADIFLGVPFNIASYALLTHLV
AHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDKHDIFDFDMKDIK
LLNYDPYPAIKAPVAV
|
|
|
|---|
| BDBM18769 |
|---|
| BDBM18754 |
|---|
| Name | BDBM18769 |
|---|
| Synonyms: | 1,8-naphthalein derivative, 17 | 4,4-bis(3-fluoro-4-hydroxyphenyl)-3-oxatricyclo[7.3.1.0^{5,13}]trideca-1(12),5,7,9(13),10-pentaen-2-one | CHEMBL303171 | Phenolnaphthalein derivative, 1 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H14F2O4 |
|---|
| Mol. Mass. | 404.3624 |
|---|
| SMILES | Oc1ccc(cc1F)C1(OC(=O)c2cccc3cccc1c23)c1ccc(O)c(F)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
