Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetThymidylate Synthase (TS)
LigandBDBM18755
Substrate/CompetitorBDBM18754
Meas. Tech.Thymidylate Synthase (TS) Assay
Ki 400±n/a nM
Citation Costi MPGelain ABarlocco DGhelli SSoragni FReniero FRossi TRuberto AGuillou CCavazzuti ACasolari CFerrari S Antibacterial agent discovery using thymidylate synthase biolibrary screening. J Med Chem 49:5958-68 (2006) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Thymidylate Synthase (TS)
Name:Thymidylate Synthase (TS)
Synonyms:TSase
Type:Enzyme
Mol. Mass.:35863.57
Organism:Cryptococcus neoformans
Description:n/a
Residue:317
Sequence:
MTATIDDQEKNQRSNPDHEEYQYLDLIRRIINVGEVRPDRTGTGTVALFAPPSFRFSLAD
NTLPLLTTKRVFLRGVIAELLWFVSGCTDAKMLSSQGVGIWDGNGSKEFLEKVGLGHRRE
GDLGPVYGFQWRHFGAEYTDADGDYKGKGVDQLQRVIDTIKNNPTDRRIILSAWNPKDLP
LMALPPCHMFCQFFVSLPPADSPGSKPKLSCLMYQRSCDLGLGVPFNIASYALLTHMIAL
ITDTEPHEFILQMGDAHVYRDHVEPLKTQLEREPRDFPKLKWARSKEEIGDIDGFKVEDF
VVEGYKPWGKIDMKMSA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM18755
BDBM18754
NameBDBM18755
Synonyms:1,2-naphthalein derivative, 1 | 3,3-bis(4-hydroxyphenyl)-4-oxatricyclo[7.4.0.0^{2,6}]trideca-1(9),2(6),7,10,12-pentaen-5-one
TypeSmall organic molecule
Emp. Form.C24H16O4
Mol. Mass.368.3814
SMILESOc1ccc(cc1)C1(OC(=O)c2ccc3ccccc3c12)c1ccc(O)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: