| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Bifunctional dihydrofolate reductase-thymidylate synthase [1-238,S58R,S117N] |
|---|
| Ligand | BDBM18776 |
|---|
| Substrate/Competitor | BDBM18044 |
|---|
| Meas. Tech. | Inhibitor Screening Using Bacterial System (IC50) and Measurement of Inhibition Constant (Ki) |
|---|
| Ki | 28.07±n/a nM |
|---|
| IC50 | 18220±n/a nM |
|---|
| Citation |  Bunyarataphan, S; Leartsakulpanich, U; Taweechai, S; Tarnchompoo, B; Kamchonwongpaisan, S; Yuthavong, Y Evaluation of the activities of pyrimethamine analogs against Plasmodium vivax and Plasmodium falciparum dihydrofolate reductase-thymidylate synthase using in vitro enzyme inhibition and bacterial complementation assays. Antimicrob Agents Chemother50:3631-7 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Bifunctional dihydrofolate reductase-thymidylate synthase [1-238,S58R,S117N] |
|---|
| Name: | Bifunctional dihydrofolate reductase-thymidylate synthase [1-238,S58R,S117N] |
|---|
| Synonyms: | DRTS_PLAVI | Dihydrofolate Reductase-Thymidylate Synthase (DHFR-TS) Muatnt (S58R/S117N) | Dihydrofolate Reductase-Thymidylate Synthase (DHFR-TS) Mutant SP21 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 27235.37 |
|---|
| Organism: | Plasmodium vivax (malaria parasite P. vivax) |
|---|
| Description: | O02604[1-238,S58R,S117N] |
|---|
| Residue: | 238 |
|---|
| Sequence: | MENLSDVFDIYAICACCKVAPTSEGTKNEPFSPRTFRGLGNKGTLPWKCNSVDMKYFRSV
TTYVDESKYEKLKWKRERYLRMEASQGGGDNTSGGDNTHGGDNADKLQNVVVMGRSNWES
IPKQYKPLPNRINVVLSKTLTKEDVKEKVFIIDSIDDLLLLLKKLKYYKCFIIGGAQVYR
ECLSRNLIKQIYFTRINGAYPCDVFFPEFDESEFRVTSVSEVYNSKGTTLDFLVYSKV
|
|
|
|---|
| BDBM18776 |
|---|
| BDBM18044 |
|---|
| Name | BDBM18776 |
|---|
| Synonyms: | 5-(4-chlorophenyl)-6-(2-methylpropyl)pyrimidine-2,4-diamine |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H17ClN4 |
|---|
| Mol. Mass. | 276.765 |
|---|
| SMILES | CC(C)Cc1nc(N)nc(N)c1-c1ccc(Cl)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
