Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDihydrofolate Reductase-Thymidylate Synthase (DHFR-TS) Mutant SP21
LigandBDBM18778
Substrate/CompetitorBDBM18044
Meas. Tech.Inhibitor Screening Using Bacterial System (IC50) and Measurement of Inhibition Constant (Ki)
Ki 7.43±n/a nM
IC50>50000±n/a nM
Citation Bunyarataphan SLeartsakulpanich UTaweechai STarnchompoo BKamchonwongpaisan SYuthavong Y Evaluation of the activities of pyrimethamine analogs against Plasmodium vivax and Plasmodium falciparum dihydrofolate reductase-thymidylate synthase using in vitro enzyme inhibition and bacterial complementation assays. Antimicrob Agents Chemother 50:3631-7 (2006) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Dihydrofolate Reductase-Thymidylate Synthase (DHFR-TS) Mutant SP21
Name:Dihydrofolate Reductase-Thymidylate Synthase (DHFR-TS) Mutant SP21
Synonyms:Dihydrofolate Reductase-Thymidylate Synthase (DHFR-TS) Muatnt (S58R/S117N)
Type:Enzyme
Mol. Mass.:27235.37
Organism:Plasmodium vivax (malaria parasite P. vivax)
Description:n/a
Residue:238
Sequence:
MENLSDVFDIYAICACCKVAPTSEGTKNEPFSPRTFRGLGNKGTLPWKCNSVDMKYFRSV
TTYVDESKYEKLKWKRERYLRMEASQGGGDNTSGGDNTHGGDNADKLQNVVVMGRSNWES
IPKQYKPLPNRINVVLSKTLTKEDVKEKVFIIDSIDDLLLLLKKLKYYKCFIIGGAQVYR
ECLSRNLIKQIYFTRINGAYPCDVFFPEFDESEFRVTSVSEVYNSKGTTLDFLVYSKV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM18778
BDBM18044
NameBDBM18778
Synonyms:CHEMBL22405 | P16 | methyl 4-[2,6-diamino-5-(4-chlorophenyl)pyrimidin-4-yl]butanoate
TypeSmall organic molecule
Emp. Form.C15H17ClN4O2
Mol. Mass.320.774
SMILESCOC(=O)CCCc1nc(N)nc(N)c1-c1ccc(Cl)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: