Reaction Details |
| Report a problem with these data |
Target | Bifunctional dihydrofolate reductase-thymidylate synthase [1-238,S58R,S117N] |
---|
Ligand | BDBM18790 |
---|
Substrate/Competitor | BDBM18044 |
---|
Meas. Tech. | Inhibitor Screening Using Bacterial System (IC50) and Measurement of Inhibition Constant (Ki) |
---|
Ki | 0.90±n/a nM |
---|
IC50 | 3020±n/a nM |
---|
Citation | Bunyarataphan, S; Leartsakulpanich, U; Taweechai, S; Tarnchompoo, B; Kamchonwongpaisan, S; Yuthavong, Y Evaluation of the activities of pyrimethamine analogs against Plasmodium vivax and Plasmodium falciparum dihydrofolate reductase-thymidylate synthase using in vitro enzyme inhibition and bacterial complementation assays. Antimicrob Agents Chemother50:3631-7 (2006) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Bifunctional dihydrofolate reductase-thymidylate synthase [1-238,S58R,S117N] |
---|
Name: | Bifunctional dihydrofolate reductase-thymidylate synthase [1-238,S58R,S117N] |
Synonyms: | DRTS_PLAVI | Dihydrofolate Reductase-Thymidylate Synthase (DHFR-TS) Muatnt (S58R/S117N) | Dihydrofolate Reductase-Thymidylate Synthase (DHFR-TS) Mutant SP21 |
Type: | Enzyme |
Mol. Mass.: | 27235.37 |
Organism: | Plasmodium vivax (malaria parasite P. vivax) |
Description: | O02604[1-238,S58R,S117N] |
Residue: | 238 |
Sequence: | MENLSDVFDIYAICACCKVAPTSEGTKNEPFSPRTFRGLGNKGTLPWKCNSVDMKYFRSV
TTYVDESKYEKLKWKRERYLRMEASQGGGDNTSGGDNTHGGDNADKLQNVVVMGRSNWES
IPKQYKPLPNRINVVLSKTLTKEDVKEKVFIIDSIDDLLLLLKKLKYYKCFIIGGAQVYR
ECLSRNLIKQIYFTRINGAYPCDVFFPEFDESEFRVTSVSEVYNSKGTTLDFLVYSKV
|
|
|
BDBM18790 |
---|
BDBM18044 |
---|
Name | BDBM18790 |
Synonyms: | 6-hexyl-5-phenylpyrimidine-2,4-diamine | CHEMBL416552 | P39 |
Type | Small organic molecule |
Emp. Form. | C16H22N4 |
Mol. Mass. | 270.3727 |
SMILES | CCCCCCc1nc(N)nc(N)c1-c1ccccc1 |
Structure |
|