Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetThyroid Hormone Receptor (TR-beta)
LigandBDBM18865
Substrate/CompetitorBDBM18860
Meas. Tech.TRbeta-Binding Assay
pH7±n/a
Temperature277.15±n/a K
IC50 0.025±n/a nM
Citation Ye LLi YLMellström KMellin CBladh LGKoehler KGarg NGarcia Collazo AMLitten CHusman BPersson KLjunggren JGrover GSleph PGGeorge RMalm J Thyroid receptor ligands. 1. Agonist ligands selective for the thyroid receptor beta1. J Med Chem 46:1580-8 (2003) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Thyroid Hormone Receptor (TR-beta)
Name:Thyroid hormone receptor
Synonyms:Nuclear receptor subfamily 1 group A member 2 | Thyroid hormone receptor | Thyroid hormone receptor beta
Type:Receptor
Mol. Mass.:52793.62
Organism:Homo sapiens (Human)
Description:Recombinant hThR was obtained from nuclear extracts from SF9 cells infected with baculovirus vectors encoding for ThRbeta 1.
Residue:461
Sequence:
MTPNSMTENGLTAWDKPKHCPDREHDWKLVGMSEACLHRKSHSERRSTLKNEQSSPHLIQ
TTWTSSIFHLDHDDVNDQSVSSAQTFQTEEKKCKGYIPSYLDKDELCVVCGDKATGYHYR
CITCEGCKGFFRRTIQKNLHPSYSCKYEGKCVIDKVTRNQCQECRFKKCIYVGMATDLVL
DDSKRLAKRKLIEENREKRRREELQKSIGHKPEPTDEEWELIKTVTEAHVATNAQGSHWK
QKRKFLPEDIGQAPIVNAPEGGKVDLEAFSHFTKIITPAITRVVDFAKKLPMFCELPCED
QIILLKGCCMEIMSLRAAVRYDPESETLTLNGEMAVTRGQLKNGGLGVVSDAIFDLGMSL
SSFNLDDTEVALLQAVLLMSSDRPGLACVERIEKYQDSFLLAFEHYINYRKHHVTHFWPK
LLMKVTDLRMIGACHASRFLHMKVECPTELFPPLFLEVFED
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM18865
BDBM18860
NameBDBM18865
Synonyms:3-{3,5-dibromo-4-[4-hydroxy-3-(propan-2-yl)phenoxy]phenyl}propanoic acid | CHEMBL289343 | dibromo phenylpropionic acid, 6
TypeSmall organic molecule
Emp. Form.C18H18Br2O4
Mol. Mass.458.141
SMILESCC(C)c1cc(Oc2c(Br)cc(CCC(O)=O)cc2Br)ccc1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: