Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetThyroid Hormone Receptor (TR-beta)
LigandBDBM18869
Substrate/CompetitorBDBM18860
Meas. Tech.TRbeta-Binding Assay and Thyroid Response Element (TRAFbeta1) Reporter Assay.
pH7±n/a
Temperature277.15±n/a K
IC50 1.1±0.029 nM
EC50 0.78±n/a nM
Citation Garg NLi YLGarcia Collazo AMLitten CRyono DEZhang MCaringal YBrigance RPMeng WWashburn WNAgback PMellström KRehnmark SRahimi-Ghadim MNorin TGrynfarb MSandberg JGrover GMalm J Thyroid receptor ligands. Part 8: Thyromimetics derived from N-acylated-alpha-amino acid derivatives displaying modulated pharmacological selectivity compared with KB-141. Bioorg Med Chem Lett 17:4131-4 (2007) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Thyroid Hormone Receptor (TR-beta)
Name:Thyroid hormone receptor
Synonyms:Nuclear receptor subfamily 1 group A member 2 | Thyroid hormone receptor | Thyroid hormone receptor beta
Type:Receptor
Mol. Mass.:52793.62
Organism:Homo sapiens (Human)
Description:Recombinant hThR was obtained from nuclear extracts from SF9 cells infected with baculovirus vectors encoding for ThRbeta 1.
Residue:461
Sequence:
MTPNSMTENGLTAWDKPKHCPDREHDWKLVGMSEACLHRKSHSERRSTLKNEQSSPHLIQ
TTWTSSIFHLDHDDVNDQSVSSAQTFQTEEKKCKGYIPSYLDKDELCVVCGDKATGYHYR
CITCEGCKGFFRRTIQKNLHPSYSCKYEGKCVIDKVTRNQCQECRFKKCIYVGMATDLVL
DDSKRLAKRKLIEENREKRRREELQKSIGHKPEPTDEEWELIKTVTEAHVATNAQGSHWK
QKRKFLPEDIGQAPIVNAPEGGKVDLEAFSHFTKIITPAITRVVDFAKKLPMFCELPCED
QIILLKGCCMEIMSLRAAVRYDPESETLTLNGEMAVTRGQLKNGGLGVVSDAIFDLGMSL
SSFNLDDTEVALLQAVLLMSSDRPGLACVERIEKYQDSFLLAFEHYINYRKHHVTHFWPK
LLMKVTDLRMIGACHASRFLHMKVECPTELFPPLFLEVFED
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM18869
BDBM18860
NameBDBM18869
Synonyms:2-{3,5-dichloro-4-[4-hydroxy-3-(propan-2-yl)phenoxy]phenyl}acetic acid | CHEMBL41036 | KB-141
TypeSmall organic molecule
Emp. Form.C17H16Cl2O4
Mol. Mass.355.213
SMILESCC(C)c1cc(Oc2c(Cl)cc(CC(O)=O)cc2Cl)ccc1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: