| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Thyroid hormone receptor beta |
|---|
| Ligand | BDBM18882 |
|---|
| Substrate/Competitor | BDBM18860 |
|---|
| Meas. Tech. | TRbeta-Binding Assay and Thyroid Response Element (TRAFbeta1) Reporter Assay. |
|---|
| pH | 7±n/a |
|---|
| Temperature | 277.15±n/a K |
|---|
| IC50 | 2600±240 nM |
|---|
| EC50 | 1100±n/a nM |
|---|
| Citation |  Garg, N; Li, YL; Garcia Collazo, AM; Litten, C; Ryono, DE; Zhang, M; Caringal, Y; Brigance, RP; Meng, W; Washburn, WN; Agback, P; Mellström, K; Rehnmark, S; Rahimi-Ghadim, M; Norin, T; Grynfarb, M; Sandberg, J; Grover, G; Malm, J Thyroid receptor ligands. Part 8: Thyromimetics derived from N-acylated-alpha-amino acid derivatives displaying modulated pharmacological selectivity compared with KB-141. Bioorg Med Chem Lett17:4131-4 (2007) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Thyroid hormone receptor beta |
|---|
| Name: | Thyroid hormone receptor beta |
|---|
| Synonyms: | ERBA2 | NR1A2 | Nuclear receptor subfamily 1 group A member 2 | THB_HUMAN | THR1 | THRB | c-erbA-2 | c-erbA-beta |
|---|
| Type: | Receptor |
|---|
| Mol. Mass.: | 52793.62 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Recombinant hThR was obtained from nuclear extracts from SF9 cells infected with baculovirus vectors encoding for ThRbeta 1. |
|---|
| Residue: | 461 |
|---|
| Sequence: | MTPNSMTENGLTAWDKPKHCPDREHDWKLVGMSEACLHRKSHSERRSTLKNEQSSPHLIQ
TTWTSSIFHLDHDDVNDQSVSSAQTFQTEEKKCKGYIPSYLDKDELCVVCGDKATGYHYR
CITCEGCKGFFRRTIQKNLHPSYSCKYEGKCVIDKVTRNQCQECRFKKCIYVGMATDLVL
DDSKRLAKRKLIEENREKRRREELQKSIGHKPEPTDEEWELIKTVTEAHVATNAQGSHWK
QKRKFLPEDIGQAPIVNAPEGGKVDLEAFSHFTKIITPAITRVVDFAKKLPMFCELPCED
QIILLKGCCMEIMSLRAAVRYDPESETLTLNGEMAVTRGQLKNGGLGVVSDAIFDLGMSL
SSFNLDDTEVALLQAVLLMSSDRPGLACVERIEKYQDSFLLAFEHYINYRKHHVTHFWPK
LLMKVTDLRMIGACHASRFLHMKVECPTELFPPLFLEVFED
|
|
|
|---|
| BDBM18882 |
|---|
| BDBM18860 |
|---|
| Name | BDBM18882 |
|---|
| Synonyms: | (2S)-2-(1-{3,5-dibromo-4-[4-hydroxy-3-methyl-5-(propan-2-yl)phenoxy]phenyl}acetamido)-3-methylbutanoic acid | N-acylated-alpha-amino acid derivative, 12 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H27Br2NO5 |
|---|
| Mol. Mass. | 557.272 |
|---|
| SMILES | CC(C)[C@H](NC(=O)Cc1cc(Br)c(Oc2cc(C)c(O)c(c2)C(C)C)c(Br)c1)C(O)=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
