| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Thyroid hormone receptor beta |
|---|
| Ligand | BDBM18887 |
|---|
| Substrate/Competitor | BDBM18860 |
|---|
| Meas. Tech. | TRbeta-Binding Assay |
|---|
| pH | 7±n/a |
|---|
| Temperature | 277.15±n/a K |
|---|
| IC50 | 190±n/a nM |
|---|
| Citation |  Koehler, K; Gordon, S; Brandt, P; Carlsson, B; Bäcksbro-Saeidi, A; Apelqvist, T; Agback, P; Grover, GJ; Nelson, W; Grynfarb, M; Färnegård, M; Rehnmark, S; Malm, J Thyroid receptor ligands. 6. A high affinity "direct antagonist" selective for the thyroid hormone receptor. J Med Chem49:6635-7 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Thyroid hormone receptor beta |
|---|
| Name: | Thyroid hormone receptor beta |
|---|
| Synonyms: | ERBA2 | NR1A2 | Nuclear receptor subfamily 1 group A member 2 | THB_HUMAN | THR1 | THRB | c-erbA-2 | c-erbA-beta |
|---|
| Type: | Receptor |
|---|
| Mol. Mass.: | 52793.62 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Recombinant hThR was obtained from nuclear extracts from SF9 cells infected with baculovirus vectors encoding for ThRbeta 1. |
|---|
| Residue: | 461 |
|---|
| Sequence: | MTPNSMTENGLTAWDKPKHCPDREHDWKLVGMSEACLHRKSHSERRSTLKNEQSSPHLIQ
TTWTSSIFHLDHDDVNDQSVSSAQTFQTEEKKCKGYIPSYLDKDELCVVCGDKATGYHYR
CITCEGCKGFFRRTIQKNLHPSYSCKYEGKCVIDKVTRNQCQECRFKKCIYVGMATDLVL
DDSKRLAKRKLIEENREKRRREELQKSIGHKPEPTDEEWELIKTVTEAHVATNAQGSHWK
QKRKFLPEDIGQAPIVNAPEGGKVDLEAFSHFTKIITPAITRVVDFAKKLPMFCELPCED
QIILLKGCCMEIMSLRAAVRYDPESETLTLNGEMAVTRGQLKNGGLGVVSDAIFDLGMSL
SSFNLDDTEVALLQAVLLMSSDRPGLACVERIEKYQDSFLLAFEHYINYRKHHVTHFWPK
LLMKVTDLRMIGACHASRFLHMKVECPTELFPPLFLEVFED
|
|
|
|---|
| BDBM18887 |
|---|
| BDBM18860 |
|---|
| Name | BDBM18887 |
|---|
| Synonyms: | 3,5-Dibromo-4-alkoxyphenylalkanoic Acid, 9k | 3-[3,5-dibromo-4-(cyclohexylmethoxy)phenyl]propanoic acid | JMC496635 Compound 9 | cyclohexyl derivative, 7 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H20Br2O3 |
|---|
| Mol. Mass. | 420.136 |
|---|
| SMILES | OC(=O)CCc1cc(Br)c(OCC2CCCCC2)c(Br)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
