Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHDAC4
LigandBDBM243189
Substrate/Competitorn/a
Meas. Tech.HDAC4 Biochemical Assay
IC50 6.00±n/a nM
Citation Maillard MCBreccia PDominguez CHaughan AFVan de Poël AStott AJLuckhurst CASaville-Stones EAWishart GWall MJarvis RE Histone deacetylase inhibitors and compositions and methods of use thereof US Patent  US10053434 Publication Date 8/21/2018
More Info.:Get all data from this article,  Assay Method
 
HDAC4
Name:HDAC4
Synonyms:Histone deacetylase 4
Type:Enzyme
Mol. Mass.:41490.90
Organism:Homo sapiens (Human)
Description:n/a
Residue:385
Sequence:
TKPRFTTGLVYDTLMLKHQCTCGSSSSHPEHAGRIQSIWSRLQETGLRGKCECIRGRKAT
LEELQTVHSEAHTLLYGTNPLNRQKLDSKKLLGSLASVFVRLPCGGVGVDSDTIWNEVHS
AGAARLAVGCVVELVFKVATGELKNGFAVVRPPGHHAEESTPMGFCYFNSVAVAAKLLQQ
RLSVSKILIVDWDVHHGNGTQQAFYSDPSVLYMSLHRYDDGNFFPGSGAPDEVGTGPGVG
FNVNMAFTGGLDPPMGDAEYLAAFRTVVMPIASEFAPDVVLVSSGFDAVEGHPTPLGGYN
LSARCFGYLTKQLMGLAGGRIVLALEGGHDLTAICDASEACVSALLGNELDPLPEKVLQQ
RPNANAVRSMEKVMEIHSKYWRCLQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM243189
n/a
NameBDBM243189
Synonyms:(R)-N-(1-(3,4-dihydro-2,7-naphthyridin- 2(1H)-yl)propan-2-yl)-4-(5- (trifluoromethyl)-1,2,4-oxadiazol-3- yl)benzamide | US10053434, 18
TypeSmall organic molecule
Emp. Form.C21H20F3N5O2
Mol. Mass.431.411
SMILESC[C@H](CN1CCc2ccncc2C1)NC(=O)c1ccc(cc1)-c1noc(n1)C(F)(F)F |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: