Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistone deacetylase 8
LigandBDBM19423
Substrate/CompetitorBDBM19411
Meas. Tech.HDAC Enzyme Activity Assay
IC50>20000±n/a nM
Citation Moradei OMMallais TCFrechette SPaquin ITessier PELeit SMFournel MBonfils CTrachy-Bourget MCLiu JYan TPLu AHRahil JWang JLefebvre SLi ZVaisburg AFBesterman JM Novel aminophenyl benzamide-type histone deacetylase inhibitors with enhanced potency and selectivity. J Med Chem 50:5543-6 (2007) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Histone deacetylase 8
Name:Histone deacetylase 8
Synonyms:HD8 | Histone deacetylase 8 (HDAC-8) | Human HDAC8
Type:Enzyme
Mol. Mass.:41749.60
Organism:Homo sapiens (Human)
Description:Q9BY41
Residue:377
Sequence:
MEEPEEPADSGQSLVPVYIYSPEYVSMCDSLAKIPKRASMVHSLIEAYALHKQMRIVKPK
VASMEEMATFHTDAYLQHLQKVSQEGDDDHPDSIEYGLGYDCPATEGIFDYAAAIGGATI
TAAQCLIDGMCKVAINWSGGWHHAKKDEASGFCYLNDAVLGILRLRRKFERILYVDLDLH
HGDGVEDAFSFTSKVMTVSLHKFSPGFFPGTGDVSDVGLGKGRYYSVNVPIQDGIQDEKY
YQICESVLKEVYQAFNPKAVVLQLGADTIAGDPMCSFNMTPVGIGKCLKYILQWQLATLI
LGGGGYNLANTARCWTYLTGVILGKTLSSEIPDHEFFTAYGPDYVLEITPSCRPDRNEPH
RIQQILNYIKGNLKHVV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM19423
BDBM19411
NameBDBM19423
Synonyms:HDAC inhibitor, Compound 1 | N-[2-amino-5-(thiophen-2-yl)phenyl]-4-acetamidobenzamide | N-[2-amino-5-(thiophen-2-yl)phenyl]-4-acetamidobenzamide (60) | SHI-1:2 | benzamide-type inhibitor, 19
TypeSmall organic molecule
Emp. Form.C19H17N3O2S
Mol. Mass.351.422
SMILESCC(=O)Nc1ccc(cc1)C(=O)Nc1cc(ccc1N)-c1cccs1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: