| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cathepsin S |
|---|
| Ligand | BDBM19688 |
|---|
| Substrate/Competitor | BDBM19546 |
|---|
| Meas. Tech. | Enzyme Inhibition Assay |
|---|
| pH | 5.5±n/a |
|---|
| Temperature | 310.15±n/a K |
|---|
| Ki | 19±n/a nM |
|---|
| Citation |  Tully, DC; Liu, H; Chatterjee, AK; Alper, PB; Williams, JA; Roberts, MJ; Mutnick, D; Woodmansee, DH; Hollenbeck, T; Gordon, P; Chang, J; Tuntland, T; Tumanut, C; Li, J; Harris, JL; Karanewsky, DS Arylaminoethyl carbamates as a novel series of potent and selective cathepsin S inhibitors. Bioorg Med Chem Lett16:5107-11 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
|---|
| |
| Cathepsin S |
|---|
| Name: | Cathepsin S |
|---|
| Synonyms: | CATS_HUMAN | CTSS | Cathepsin S (Cat S) | cathepsin S preproprotein |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 37507.38 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P25774 |
|---|
| Residue: | 331 |
|---|
| Sequence: | MKRLVCVLLVCSSAVAQLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVM
LHNLEHSMGMHSYDLGMNHLGDMTSEEVMSLMSSLRVPSQWQRNITYKSNPNRILPDSVD
WREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGC
NGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKE
AVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSW
GHNFGEEGYIRMARNKGNHCGIASFPSYPEI
|
|
|
|---|
| BDBM19688 |
|---|
| BDBM19546 |
|---|
| Name | BDBM19688 |
|---|
| Synonyms: | (2S)-3-cyclohexyl-1-(morpholin-4-yl)-1-oxopropan-2-yl N-[(1S)-1-cyclopropyl-2-(5-fluoro-3,3-dimethyl-2,3-dihydro-1H-indol-1-yl)ethyl]carbamate | Arylaminoethyl carbamate, 19 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C29H42FN3O4 |
|---|
| Mol. Mass. | 515.6599 |
|---|
| SMILES | CC1(C)CN(C[C@@H](NC(=O)O[C@@H](CC2CCCCC2)C(=O)N2CCOCC2)C2CC2)c2ccc(F)cc12 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
