Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCathepsin K
LigandBDBM19775
Substrate/CompetitorBDBM19485
Meas. Tech.Enzyme Inhibition Assay
Ki 73±n/a nM
Citation Yamashita DSMarquis RWXie RNidamarthy SDOh HJJeong JUErhard KFWard KWRoethke TJSmith BRCheng HYGeng XLin FOffen PHWang BNevins NHead MSHaltiwanger RCNarducci Sarjeant AALiable-Sands LMZhao BSmith WWJanson CAGao ETomaszek TMcQueney MJames IEGress CJZembryki DLLark MWVeber DF Structure activity relationships of 5-, 6-, and 7-methyl-substituted azepan-3-one cathepsin K inhibitors. J Med Chem 49:1597-612 (2006) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Cathepsin K
Name:Cathepsin K
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:36798.82
Organism:Rattus norvegicus
Description:ChEMBL_633322
Residue:329
Sequence:
MWVFKFLLLPVVSFALSPEETLDTQWELWKKTHGKQYNSKVDEISRRLIWEKNLKKISVH
NLEASLGAHTYELAMNHLGDMTSEEVVQKMTGLRVPPSRSFSNDTLYTPEWEGRVPDSID
YRKKGYVTPVKNQGQCGSCWAFSSAGALEGQLKKKTGKLLALSPQNLVDCVSENYGCGGG
YMTTAFQYVQQNGGIDSEDAYPYVGQDESCMYNATAKAAKCRGYREIPVGNEKALKRAVA
RVGPVSVSIDASLTSFQFYSRGVYYDENCDRDNVNHAVLVVGYGTQKGNKYWIIKNSWGE
SWGNKGYVLLARNKNNACGITNLASFPKM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM19775
BDBM19485
NameBDBM19775
Synonyms:(2S)-2-(1-benzofuran-2-ylformamido)-4-methyl-N-[(4S,6S)-6-methyl-3-oxo-1-(pyridine-2-sulfonyl)azepan-4-yl]pentanamide | Azepan-3-one compound 7
TypeSmall organic molecule
Emp. Form.C27H32N4O6S
Mol. Mass.540.631
SMILESCC(C)C[C@H](NC(=O)c1cc2ccccc2o1)C(=O)N[C@H]1C[C@H](C)CN(CC1=O)S(=O)(=O)c1ccccn1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: