| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cathepsin K |
|---|
| Ligand | BDBM19908 |
|---|
| Substrate/Competitor | BDBM19480 |
|---|
| Meas. Tech. | In Vitro Enzyme Inhibition Assay and Bone-Resorption Assay |
|---|
| pH | 5.5±n/a |
|---|
| Temperature | 295.15±n/a K |
|---|
| IC50 | 0.2±n/a nM |
|---|
| EC50 | 17±n/a nM |
|---|
| Citation |  Robichaud, J; Bayly, CI; Black, WC; Desmarais, S; Léger, S; Massé, F; McKay, DJ; Oballa, RM; Pâquet, J; Percival, MD; Truchon, JF; Wesolowski, G; Crane, SN Beta-substituted cyclohexanecarboxamide cathepsin K inhibitors: modification of the 1,2-disubstituted aromatic core. Bioorg Med Chem Lett17:3146-51 (2007) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
|---|
| |
| Cathepsin K |
|---|
| Name: | Cathepsin K |
|---|
| Synonyms: | CATK_RABIT | CTSK |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 36879.51 |
|---|
| Organism: | Oryctolagus cuniculus (rabbit) |
|---|
| Description: | n/a |
|---|
| Residue: | 329 |
|---|
| Sequence: | MWGLKVLLLPVVSFALHPEEILDTQWELWKKTYSKQYNSKVDEISRRLIWEKNLKHISIH
NLEASLGVHTYELAMNHLGDMTSEEVVQKMTGLKVPPSRSHSNDTLYIPDWEGRTPDSID
YRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENYGCGGG
YMTNAFQYVQRNRGIDSEDAYPYVGQDESCMYNPTGKAAKCRGYREIPEGNEKALKRAVA
RVGPVSVAIDASLTSFQFYSKGVYYDENCSSDNVNHAVLAVGYGIQKGNKHWIIKNSWGE
SWGNKGYILMARNKNNACGIANLASFPKM
|
|
|
|---|
| BDBM19908 |
|---|
| BDBM19480 |
|---|
| Name | BDBM19908 |
|---|
| Synonyms: | (1R,2R)-N-(cyanomethyl)-5,5-difluoro-2-{2-methyl-4-[4-(methylsulfanyl)phenyl]-1,3-thiazol-5-yl}cyclohexane-1-carboxamide | beta-substituted cyclohexanecarboxamide, 9 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H21F2N3OS2 |
|---|
| Mol. Mass. | 421.527 |
|---|
| SMILES | CSc1ccc(cc1)-c1nc(C)sc1[C@@H]1CCC(F)(F)C[C@H]1C(=O)NCC#N |r| |
|---|
| Structure | 
|
|---|
Search and Browse
