| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Estrogen receptor beta |
|---|
| Ligand | BDBM19441 |
|---|
| Substrate/Competitor | 17beta-estradiol (E2) |
|---|
| Meas. Tech. | Estrogen Receptor Binding Assay and Ishikawa Assay |
|---|
| pH | 7.5±n/a |
|---|
| Temperature | 295.15±n/a K |
|---|
| Ki | 2.74±1.37 nM |
|---|
| EC50 | 4.32±1.69 nM |
|---|
| Citation |  Hummel, CW; Geiser, AG; Bryant, HU; Cohen, IR; Dally, RD; Fong, KC; Frank, SA; Hinklin, R; Jones, SA; Lewis, G; McCann, DJ; Rudmann, DG; Shepherd, TA; Tian, H; Wallace, OB; Wang, M; Wang, Y; Dodge, JA A selective estrogen receptor modulator designed for the treatment of uterine leiomyoma with unique tissue specificity for uterus and ovaries in rats. J Med Chem48:6772-5 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Estrogen receptor beta |
|---|
| Name: | Estrogen receptor beta |
|---|
| Synonyms: | ER-beta | ESR2 | ESR2_HUMAN | ESTRB | Estradiol receptor beta (ERβ) | Estrogen receptor | Estrogen receptor (ER beta) | Estrogen receptor beta | Estrogen receptor beta (ER beta) | Estrogen receptor beta (ER) | NR3A2 | Nuclear receptor subfamily 3 group A member 2 | estrogen beta |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 59238.43 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q92731 |
|---|
| Residue: | 530 |
|---|
| Sequence: | MDIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPS
NVTNLEGGPGRQTTSPNVLWPTPGHLSPLVVHRQLSHLYAEPQKSPWCEARSLEHTLPVN
RETLKRKVSGNRCASPVTGPGSKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGH
NDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRLVRRQRSADEQLH
CAGKAKRSGGHAPRVRELLLDALSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTK
LADKELVHMISWAKKIPGFVELSLFDQVRLLESCWMEVLMMGLMWRSIDHPGKLIFAPDL
VLDRDEGKCVEGILEIFDMLLATTSRFRELKLQHKEYLCVKAMILLNSSMYPLVTATQDA
DSSRKLAHLLNAVTDALVWVIAKSGISSQQQSMRLANLLMLLSHVRHASNKGMEHLLNMK
CKNVVPVYDLLLEMLNAHVLRGCKSSITGSECSPAEDSKSKEGSQNPQSQ
|
|
|
|---|
| BDBM19441 |
|---|
| 17beta-estradiol (E2) |
|---|
| Name | BDBM19441 |
|---|
| Synonyms: | 2-(4-hydroxyphenyl)-3-({4-[2-(piperidin-1-yl)ethoxy]phenyl}carbonyl)-1-benzothiophen-6-ol | CHEMBL81 | Evista | Keoxifene | RALOXIFENE HYDROCHLORIDE | Raloxifene | Raloxifene (7) | Raloxifene, 6 | [6-hydroxy-2-(4-hydroxyphenyl)-1-benzothiophen-3-yl]-[4-(2-piperidin-1-ylethoxy)phenyl]methanone | cid_11071264 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C28H27NO4S |
|---|
| Mol. Mass. | 473.583 |
|---|
| SMILES | Oc1ccc(cc1)-c1sc2cc(O)ccc2c1C(=O)c1ccc(OCCN2CCCCC2)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
